DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rols and AT4G03500

DIOPT Version :9

Sequence 1:NP_729778.1 Gene:rols / 39368 FlyBaseID:FBgn0041096 Length:1900 Species:Drosophila melanogaster
Sequence 2:NP_192259.1 Gene:AT4G03500 / 827731 AraportID:AT4G03500 Length:652 Species:Arabidopsis thaliana


Alignment Length:388 Identity:87/388 - (22%)
Similarity:140/388 - (36%) Gaps:127/388 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  1406 LTNSQGCTPLILAAMRGHCDVVR-------PLVAAGSSLGQLDITQRCALVHAARMGHLSVVKYL 1463
            |.|.:|.|.|.|||..||..:||       .|:...:.:|::      ||..||..|||.||..|
plant    97 LVNDRGNTILHLAASSGHVSLVRYIIQKCPGLLLKSNMMGEV------ALHLAAEAGHLDVVWNL 155

  Fly  1464 ------LACDWSP--------RPHSQDVTRSVALQQALIGAAAQAHCKILEDLLDLNETEFDLDV 1514
                  ::|...|        :..:||....|||:                              
plant   156 IDFINDISCTNLPVAKRIYFAKNKNQDTALHVALK------------------------------ 190

  Fly  1515 NGMEPSSGELALTAAARHGCIDVVGILLSRGAQID-ARNRQGYSALWLAVKEGHWSVVEHLLQRG 1578
                           .:|..  |...|:|....:. ..||.|:|.|:||::.||.|:|..:....
plant   191 ---------------GKHEV--VASYLVSAAKSLSFVANRDGFSPLYLAIEAGHTSLVTTMCHGT 238

  Fly  1579 ALLDEPLGQTRKTPLMIAAEEGHLELVDLLLARGAQREAQDHEGFTALSW--------------- 1628
            ..|...:|  .::.:..|.:....:::|.||::.|.......||.|:||:               
plant   239 NELSSKVG--GRSIVHAALKANRKDILDALLSKDASLINLRDEGRTSLSFGASIGYYQGFSYLFD 301

  Fly  1629 -------------------ACLRGHLAAAKTLIEHGCNRHHE--DHNGRTALDLAAYQGAASLVI 1672
                               |...||:...:.:::| |....|  |.:|:..|.|||..|...::.
plant   302 KNRDKVYVSDDDGLFPTHMAAKYGHVQILEEILKH-CPEAIELLDRDGQNILHLAAKYGKLKVIK 365

  Fly  1673 YILE--QGGNLEHI----DVHGMRPLDRAIACRNIQAVQVF-------LRKGAKLGPTTWSMA 1722
            :||.  :..|.:.:    ||:|..||..|....:.:.|.:|       |:|...:|.|...:|
plant   366 FILSCCKDKNKKKLINEQDVNGNTPLHLATINWHPKVVSMFTWDHRVDLKKRNYIGFTALDVA 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rolsNP_729778.1 zf-RING_5 327..364 CDD:291308
Ank_5 1363..1418 CDD:290568 5/11 (45%)
ANK 1378..1503 CDD:238125 31/117 (26%)
ANK repeat 1382..1408 CDD:293786 1/1 (100%)
ANK repeat 1410..1441 CDD:293786 12/37 (32%)
Ank_2 1415..1552 CDD:289560 31/158 (20%)
ANK 1486..1609 CDD:238125 19/123 (15%)
ANK repeat 1486..1518 CDD:293786 0/31 (0%)
ANK repeat 1521..1552 CDD:293786 4/31 (13%)
Ank_2 1526..1619 CDD:289560 22/93 (24%)
ANK 1549..1675 CDD:238125 36/162 (22%)
ANK repeat 1554..1586 CDD:293786 10/31 (32%)
ANK repeat 1591..1619 CDD:293786 5/27 (19%)
Ank_2 1593..1685 CDD:289560 26/133 (20%)
ANK repeat 1621..1652 CDD:293786 11/66 (17%)
ANK repeat 1654..1685 CDD:293786 9/36 (25%)
Ank_2 1659..1735 CDD:289560 21/77 (27%)
ANK repeat 1687..1712 CDD:293786 8/31 (26%)
TPR_11 1736..1812 CDD:290150
TPR repeat 1736..1768 CDD:276809
TPR repeat 1773..1810 CDD:276809
TPR_11 1783..1843 CDD:290150
TPR repeat 1815..1843 CDD:276809
AT4G03500NP_192259.1 Ank_2 73..166 CDD:289560 25/74 (34%)
ANK 98..231 CDD:238125 44/185 (24%)
ANK repeat 101..132 CDD:293786 11/30 (37%)
ANK repeat 135..178 CDD:293786 13/48 (27%)
Ank_2 185..278 CDD:289560 25/141 (18%)
ANK 212..368 CDD:238125 36/158 (23%)
ANK repeat 214..244 CDD:293786 10/29 (34%)
ANK repeat 246..278 CDD:293786 6/33 (18%)
ANK 311..437 CDD:238125 29/119 (24%)
ANK repeat 313..345 CDD:293786 6/32 (19%)
Ank_2 319..418 CDD:289560 26/99 (26%)
ANK repeat 347..384 CDD:293786 9/36 (25%)
ANK repeat 386..418 CDD:293786 8/31 (26%)
PGG 473..581 CDD:290670
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1009
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.