DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rols and Ankrd63

DIOPT Version :9

Sequence 1:NP_729778.1 Gene:rols / 39368 FlyBaseID:FBgn0041096 Length:1900 Species:Drosophila melanogaster
Sequence 2:XP_006234855.1 Gene:Ankrd63 / 691770 RGDID:1595953 Length:390 Species:Rattus norvegicus


Alignment Length:166 Identity:51/166 - (30%)
Similarity:72/166 - (43%) Gaps:17/166 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1519 PSSGELALTAAARHGCIDVVGILLSR--GAQIDARNRQGYSALWLAV----KEGHWSVVEHLLQR 1577
            |.:|......|.:.|.:.:...:|..  .:.||.|..||.:.|.:||    .......|..||::
  Rat     9 PRAGTRTFLEAMQAGKVHLARFVLDALDRSIIDCRAEQGRTPLMVAVGLPDPAMRSRFVRLLLEQ 73

  Fly  1578 GA---LLDEPLGQTRKTPLMIAAEEGHLELVDLLLARGAQREAQDHEGFTALSWACLRGHLAAAK 1639
            ||   |.||    ..:|.|.:|.|.|||:.|.||:......||.|..|.:.:.||...||.|..:
  Rat    74 GAAVNLRDE----RGRTALSLACERGHLDAVQLLVQYSGDPEATDSAGNSPVMWAAACGHGAVLE 134

  Fly  1640 TLIEH----GCNRHHEDHNGRTALDLAAYQGAASLV 1671
            .|:..    |......:..|.|||.|||.:|..:.|
  Rat   135 FLVRSFRRLGLRLDRTNRAGLTALQLAASRGHGTCV 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rolsNP_729778.1 zf-RING_5 327..364 CDD:291308
Ank_5 1363..1418 CDD:290568
ANK 1378..1503 CDD:238125
ANK repeat 1382..1408 CDD:293786
ANK repeat 1410..1441 CDD:293786
Ank_2 1415..1552 CDD:289560 7/34 (21%)
ANK 1486..1609 CDD:238125 30/98 (31%)
ANK repeat 1486..1518 CDD:293786
ANK repeat 1521..1552 CDD:293786 6/32 (19%)
Ank_2 1526..1619 CDD:289560 31/101 (31%)
ANK 1549..1675 CDD:238125 45/134 (34%)
ANK repeat 1554..1586 CDD:293786 13/38 (34%)
ANK repeat 1591..1619 CDD:293786 12/27 (44%)
Ank_2 1593..1685 CDD:289560 29/83 (35%)
ANK repeat 1621..1652 CDD:293786 8/34 (24%)
ANK repeat 1654..1685 CDD:293786 9/18 (50%)
Ank_2 1659..1735 CDD:289560 6/13 (46%)
ANK repeat 1687..1712 CDD:293786
TPR_11 1736..1812 CDD:290150
TPR repeat 1736..1768 CDD:276809
TPR repeat 1773..1810 CDD:276809
TPR_11 1783..1843 CDD:290150
TPR repeat 1815..1843 CDD:276809
Ankrd63XP_006234855.1 Ank_2 16..114 CDD:289560 31/101 (31%)
ANK 41..173 CDD:238125 45/134 (34%)
ANK repeat 47..81 CDD:293786 10/33 (30%)
ANK repeat 83..114 CDD:293786 12/30 (40%)
Ank_4 117..173 CDD:290365 17/54 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1073736at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.