Sequence 1: | NP_729778.1 | Gene: | rols / 39368 | FlyBaseID: | FBgn0041096 | Length: | 1900 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001102897.1 | Gene: | Ankrd65 / 680734 | RGDID: | 1588232 | Length: | 365 | Species: | Rattus norvegicus |
Alignment Length: | 335 | Identity: | 101/335 - (30%) |
---|---|---|---|
Similarity: | 139/335 - (41%) | Gaps: | 79/335 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 1353 SPNLKVSRLVLLAGASPNHRTDYMGGAPILCIAAHEGILPMVSLLLEFGADVGLTNSQGCTPLIL 1417
Fly 1418 AAMRGHCDVVRPLVAAGSS------------------LGQL-----------------DITQRCA 1447
Fly 1448 LVHAARMGHLSVVKYLLACDWSPRPHSQDVTRSVALQQALIGAAAQAHCKILEDLLDLNETEFDL 1512
Fly 1513 DV-----------------------NGMEPS----SGELALTAAARHGCIDVVGILLSRGAQIDA 1550
Fly 1551 RNRQGYSALWLAVKEGHWSVVEHLLQRGALLDEPLGQTRKTPLMIAAEEGHLELVDLLLARGAQR 1615
Fly 1616 EAQDHEGFTA 1625 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rols | NP_729778.1 | zf-RING_5 | 327..364 | CDD:291308 | |
Ank_5 | 1363..1418 | CDD:290568 | 23/54 (43%) | ||
ANK | 1378..1503 | CDD:238125 | 43/159 (27%) | ||
ANK repeat | 1382..1408 | CDD:293786 | 11/25 (44%) | ||
ANK repeat | 1410..1441 | CDD:293786 | 14/65 (22%) | ||
Ank_2 | 1415..1552 | CDD:289560 | 45/198 (23%) | ||
ANK | 1486..1609 | CDD:238125 | 46/149 (31%) | ||
ANK repeat | 1486..1518 | CDD:293786 | 10/54 (19%) | ||
ANK repeat | 1521..1552 | CDD:293786 | 10/30 (33%) | ||
Ank_2 | 1526..1619 | CDD:289560 | 39/92 (42%) | ||
ANK | 1549..1675 | CDD:238125 | 34/77 (44%) | ||
ANK repeat | 1554..1586 | CDD:293786 | 14/31 (45%) | ||
ANK repeat | 1591..1619 | CDD:293786 | 13/27 (48%) | ||
Ank_2 | 1593..1685 | CDD:289560 | 13/33 (39%) | ||
ANK repeat | 1621..1652 | CDD:293786 | 2/5 (40%) | ||
ANK repeat | 1654..1685 | CDD:293786 | |||
Ank_2 | 1659..1735 | CDD:289560 | |||
ANK repeat | 1687..1712 | CDD:293786 | |||
TPR_11 | 1736..1812 | CDD:290150 | |||
TPR repeat | 1736..1768 | CDD:276809 | |||
TPR repeat | 1773..1810 | CDD:276809 | |||
TPR_11 | 1783..1843 | CDD:290150 | |||
TPR repeat | 1815..1843 | CDD:276809 | |||
Ankrd65 | NP_001102897.1 | ANK | 33..149 | CDD:238125 | 35/107 (33%) |
ANK repeat | 33..63 | CDD:293786 | 7/20 (35%) | ||
Ank_2 | 37..123 | CDD:289560 | 31/81 (38%) | ||
ANK repeat | 65..96 | CDD:293786 | 13/31 (42%) | ||
ANK repeat | 98..123 | CDD:293786 | 10/24 (42%) | ||
ANK repeat | 197..224 | CDD:293786 | 7/26 (27%) | ||
Ank_2 | 198..290 | CDD:289560 | 20/91 (22%) | ||
ANK | 221..346 | CDD:238125 | 39/125 (31%) | ||
ANK repeat | 227..257 | CDD:293786 | 2/29 (7%) | ||
ANK repeat | 259..290 | CDD:293786 | 10/30 (33%) | ||
Ank_2 | 264..355 | CDD:289560 | 39/91 (43%) | ||
ANK repeat | 292..323 | CDD:293786 | 14/31 (45%) | ||
ANK repeat | 325..355 | CDD:293786 | 14/29 (48%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166343657 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | LDO | PTHR24166 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |