DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rols and ANKRD65

DIOPT Version :10

Sequence 1:NP_729778.1 Gene:rols / 39368 FlyBaseID:FBgn0041096 Length:1900 Species:Drosophila melanogaster
Sequence 2:NP_001138682.1 Gene:ANKRD65 / 441869 HGNCID:42950 Length:399 Species:Homo sapiens


Alignment Length:335 Identity:101/335 - (30%)
Similarity:145/335 - (43%) Gaps:49/335 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1385 AAHEGILPMVSLLLEFGADVGLTNSQGCTPLILAAMRGHCDVVRPLVAAGSSLGQLDITQRCALV 1449
            |...|...:|:.||..||.|...:..|.|||.||.:|||..:||.|:..|:.:|.:|...|.||.
Human    48 AVWRGPAGLVTQLLRQGASVEERDHAGRTPLHLAVLRGHAPLVRLLLQRGAPVGAVDRAGRTALH 112

  Fly  1450 HAARMGHLSVVKYLLACDWSPRPHSQDVTRSVALQQALIGAAAQAHCKILEDLLDLNETEFDLDV 1514
            .||..||..|.:.||      :..:....||......|..|||..|..:...||:          
Human   113 EAAWHGHSRVAELLL------QRGASAAARSGTGLTPLHWAAALGHTLLAARLLE---------- 161

  Fly  1515 NGMEPSSGELALTAAARHGCIDVVGILLSRGAQIDARNRQGYSALWLAVKEGHWSVVEHLLQRGA 1579
               .|..|    .|||                  :|.:.:|::|...|...|..:|:|.|...||
Human   162 ---APGPG----PAAA------------------EAEDARGWTAAHWAAAGGRLAVLELLAAGGA 201

  Fly  1580 LLDEPLGQTRKTPLMIAAEEGHLELVDLLLARGAQREAQDHEGFTALSWACLRGHLAAAKTLIEH 1644
            .||        ..|::||..|....:..||||||:.:|:|..|.|||..|...|.....:.|:.|
Human   202 GLD--------GALLVAAAAGRGAALRFLLARGARVDARDGAGATALGLAAALGRSQDIEVLLGH 258

  Fly  1645 GCNRHHEDHNGRTALDLAAYQGAASLVIYILEQGGNLEHIDVHGMRPLDRAIACRNIQAVQVFLR 1709
            |.:....|.:||:||..||.:|....|..::.||..::..|..|:.||..|....:::.....|.
Human   259 GADPGIRDRHGRSALHRAAARGHLLAVQLLVTQGAEVDARDTLGLTPLHHASREGHVEVAGCLLD 323

  Fly  1710 KGAKLGPTTW 1719
            :||::..|.|
Human   324 RGAQVDATGW 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rolsNP_729778.1 zf-RING_5 327..364 CDD:434085
Ank_2 1382..1467 CDD:463710 33/81 (41%)
ANK repeat 1382..1408 CDD:293786 8/22 (36%)
ANK repeat 1410..1441 CDD:293786 14/30 (47%)
ANKYR 1481..1714 CDD:440430 64/232 (28%)
ANK repeat 1486..1518 CDD:293786 7/31 (23%)
ANK repeat 1521..1552 CDD:293786 5/30 (17%)
ANK repeat 1554..1586 CDD:293786 11/31 (35%)
ANK repeat 1591..1619 CDD:293786 11/27 (41%)
Spy 1608..>1847 CDD:443119 38/112 (34%)
ANK repeat 1621..1652 CDD:293786 9/30 (30%)
ANK repeat 1654..1685 CDD:293786 10/30 (33%)
ANK repeat 1687..1712 CDD:293786 5/24 (21%)
TPR repeat 1736..1768 CDD:276809
TPR repeat 1773..1810 CDD:276809
TPR repeat 1815..1843 CDD:276809
ANKRD65NP_001138682.1 ANK 1 40..69 8/20 (40%)
ANKYR 44..359 CDD:440430 101/335 (30%)
ANK repeat 45..71 CDD:293786 8/22 (36%)
ANK 2 73..102 13/28 (46%)
ANK repeat 74..104 CDD:293786 14/29 (48%)
ANK repeat 106..137 CDD:293786 10/36 (28%)
ANK 3 106..135 10/34 (29%)
ANK 4 139..168 9/45 (20%)
ANK 5 176..205 11/36 (31%)
ANK 6 207..231 10/23 (43%)
ANK 7 235..264 9/28 (32%)
ANK repeat 268..299 CDD:293786 10/30 (33%)
ANK 8 268..297 10/28 (36%)
ANK repeat 301..332 CDD:293786 7/30 (23%)
ANK 9 301..330 7/28 (25%)
ANK repeat 334..364 CDD:293786 101/335 (30%)
ANK 10 334..363 101/335 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 377..399
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.