Sequence 1: | NP_729778.1 | Gene: | rols / 39368 | FlyBaseID: | FBgn0041096 | Length: | 1900 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001138682.1 | Gene: | ANKRD65 / 441869 | HGNCID: | 42950 | Length: | 399 | Species: | Homo sapiens |
Alignment Length: | 335 | Identity: | 101/335 - (30%) |
---|---|---|---|
Similarity: | 145/335 - (43%) | Gaps: | 49/335 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 1385 AAHEGILPMVSLLLEFGADVGLTNSQGCTPLILAAMRGHCDVVRPLVAAGSSLGQLDITQRCALV 1449
Fly 1450 HAARMGHLSVVKYLLACDWSPRPHSQDVTRSVALQQALIGAAAQAHCKILEDLLDLNETEFDLDV 1514
Fly 1515 NGMEPSSGELALTAAARHGCIDVVGILLSRGAQIDARNRQGYSALWLAVKEGHWSVVEHLLQRGA 1579
Fly 1580 LLDEPLGQTRKTPLMIAAEEGHLELVDLLLARGAQREAQDHEGFTALSWACLRGHLAAAKTLIEH 1644
Fly 1645 GCNRHHEDHNGRTALDLAAYQGAASLVIYILEQGGNLEHIDVHGMRPLDRAIACRNIQAVQVFLR 1709
Fly 1710 KGAKLGPTTW 1719 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rols | NP_729778.1 | zf-RING_5 | 327..364 | CDD:291308 | |
Ank_5 | 1363..1418 | CDD:290568 | 12/32 (38%) | ||
ANK | 1378..1503 | CDD:238125 | 40/117 (34%) | ||
ANK repeat | 1382..1408 | CDD:293786 | 8/22 (36%) | ||
ANK repeat | 1410..1441 | CDD:293786 | 14/30 (47%) | ||
Ank_2 | 1415..1552 | CDD:289560 | 37/136 (27%) | ||
ANK | 1486..1609 | CDD:238125 | 28/122 (23%) | ||
ANK repeat | 1486..1518 | CDD:293786 | 7/31 (23%) | ||
ANK repeat | 1521..1552 | CDD:293786 | 5/30 (17%) | ||
Ank_2 | 1526..1619 | CDD:289560 | 26/92 (28%) | ||
ANK | 1549..1675 | CDD:238125 | 42/125 (34%) | ||
ANK repeat | 1554..1586 | CDD:293786 | 11/31 (35%) | ||
ANK repeat | 1591..1619 | CDD:293786 | 11/27 (41%) | ||
Ank_2 | 1593..1685 | CDD:289560 | 32/91 (35%) | ||
ANK repeat | 1621..1652 | CDD:293786 | 9/30 (30%) | ||
ANK repeat | 1654..1685 | CDD:293786 | 10/30 (33%) | ||
Ank_2 | 1659..1735 | CDD:289560 | 17/61 (28%) | ||
ANK repeat | 1687..1712 | CDD:293786 | 5/24 (21%) | ||
TPR_11 | 1736..1812 | CDD:290150 | |||
TPR repeat | 1736..1768 | CDD:276809 | |||
TPR repeat | 1773..1810 | CDD:276809 | |||
TPR_11 | 1783..1843 | CDD:290150 | |||
TPR repeat | 1815..1843 | CDD:276809 | |||
ANKRD65 | NP_001138682.1 | ANK 1 | 40..69 | 8/20 (40%) | |
ANK | <41..94 | CDD:238125 | 19/45 (42%) | ||
Ank_2 | 45..136 | CDD:289560 | 33/93 (35%) | ||
ANK repeat | 45..71 | CDD:293786 | 8/22 (36%) | ||
ANK | 69..192 | CDD:238125 | 44/163 (27%) | ||
ANK 2 | 73..102 | 13/28 (46%) | |||
ANK repeat | 74..104 | CDD:293786 | 14/29 (48%) | ||
ANK repeat | 106..137 | CDD:293786 | 10/36 (28%) | ||
ANK 3 | 106..135 | 10/34 (29%) | |||
ANK 4 | 139..168 | 9/45 (20%) | |||
Ank_2 | 144..299 | CDD:289560 | 56/197 (28%) | ||
ANK 5 | 176..205 | 11/36 (31%) | |||
ANK 6 | 207..231 | 10/23 (43%) | |||
ANK 7 | 235..264 | 9/28 (32%) | |||
ANK | 252..355 | CDD:238125 | 24/82 (29%) | ||
ANK repeat | 268..299 | CDD:293786 | 10/30 (33%) | ||
ANK 8 | 268..297 | 10/28 (36%) | |||
Ank_2 | 273..364 | CDD:289560 | 17/61 (28%) | ||
ANK repeat | 301..332 | CDD:293786 | 7/30 (23%) | ||
ANK 9 | 301..330 | 7/28 (25%) | |||
ANK repeat | 334..364 | CDD:293786 | 101/335 (30%) | ||
ANK 10 | 334..363 | 101/335 (30%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 377..399 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165149763 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | LDO | PTHR24166 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |