| Sequence 1: | NP_729778.1 | Gene: | rols / 39368 | FlyBaseID: | FBgn0041096 | Length: | 1900 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001017375.2 | Gene: | Mphosph8 / 290270 | RGDID: | 1305133 | Length: | 851 | Species: | Rattus norvegicus |
| Alignment Length: | 339 | Identity: | 75/339 - (22%) |
|---|---|---|---|
| Similarity: | 122/339 - (35%) | Gaps: | 120/339 - (35%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1503 LDLNETEFDLDVNGMEPSSGELALTAAARHGCIDVVGILLSRGAQIDARNRQGYSALWLAVKEGH 1567
Fly 1568 WSVVEHLLQRGALLDEPLGQTRKTPLMIAAEEGHLELVDLLLARGAQREAQDHEGFTALSWACLR 1632
Fly 1633 GHLAAAKTLIEHG--CNRHHEDHNGRTALDLAAYQGAASLVIYILEQGGNL---EHIDVHGMRPL 1692
Fly 1693 DRA---------------------IACRNI---------------------QAVQVFLRKGAKLG 1715
Fly 1716 PTTWSMAMGKPEILVILLNKLLEDGNVLYRKNRFQEAA---HRYQYALRKISGLEQLLER--NAI 1775
Fly 1776 FAQLRTNLLLNLSR 1789 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| rols | NP_729778.1 | zf-RING_5 | 327..364 | CDD:291308 | |
| Ank_5 | 1363..1418 | CDD:290568 | |||
| ANK | 1378..1503 | CDD:238125 | 75/339 (22%) | ||
| ANK repeat | 1382..1408 | CDD:293786 | |||
| ANK repeat | 1410..1441 | CDD:293786 | |||
| Ank_2 | 1415..1552 | CDD:289560 | 16/48 (33%) | ||
| ANK | 1486..1609 | CDD:238125 | 25/105 (24%) | ||
| ANK repeat | 1486..1518 | CDD:293786 | 6/14 (43%) | ||
| ANK repeat | 1521..1552 | CDD:293786 | 8/30 (27%) | ||
| Ank_2 | 1526..1619 | CDD:289560 | 20/92 (22%) | ||
| ANK | 1549..1675 | CDD:238125 | 31/127 (24%) | ||
| ANK repeat | 1554..1586 | CDD:293786 | 1/31 (3%) | ||
| ANK repeat | 1591..1619 | CDD:293786 | 11/27 (41%) | ||
| Ank_2 | 1593..1685 | CDD:289560 | 31/96 (32%) | ||
| ANK repeat | 1621..1652 | CDD:293786 | 13/32 (41%) | ||
| ANK repeat | 1654..1685 | CDD:293786 | 7/33 (21%) | ||
| Ank_2 | 1659..1735 | CDD:289560 | 19/120 (16%) | ||
| ANK repeat | 1687..1712 | CDD:293786 | 8/66 (12%) | ||
| TPR_11 | 1736..1812 | CDD:290150 | 12/59 (20%) | ||
| TPR repeat | 1736..1768 | CDD:276809 | 4/34 (12%) | ||
| TPR repeat | 1773..1810 | CDD:276809 | 6/17 (35%) | ||
| TPR_11 | 1783..1843 | CDD:290150 | 3/7 (43%) | ||
| TPR repeat | 1815..1843 | CDD:276809 | |||
| Mphosph8 | NP_001017375.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 21..54 | ||
| CHROMO | 58..109 | CDD:214605 | |||
| Histone H3K9me3 binding. /evidence=ECO:0000250|UniProtKB:Q99549 | 80..87 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 133..174 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 240..302 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 315..428 | ||||
| ANK | 586..710 | CDD:238125 | 45/175 (26%) | ||
| ANK 1 | 591..620 | 8/28 (29%) | |||
| ANK repeat | 594..622 | CDD:293786 | 7/27 (26%) | ||
| Ank_2 | 597..686 | CDD:289560 | 34/134 (25%) | ||
| ANK repeat | 624..655 | CDD:293786 | 12/64 (19%) | ||
| ANK 2 | 624..653 | 12/62 (19%) | |||
| ANK repeat | 657..686 | CDD:293786 | 13/40 (33%) | ||
| ANK 3 | 657..686 | 13/40 (33%) | |||
| ANK 4 | 690..719 | 8/32 (25%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24166 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.100 | |||||