DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment rols and Y38C1AA.19

DIOPT Version :9

Sequence 1:	NP_729778.1	Gene:	rols / 39368	FlyBaseID:	FBgn0041096	Length:	1900	Species:	Drosophila melanogaster
Sequence 2:	NP_001294309.1	Gene:	Y38C1AA.19 / 24105070	WormBaseID:	WBGene00219750	Length:	149	Species:	Caenorhabditis elegans

Alignment Length:	138	Identity:	32/138 - (23%)
Similarity:	54/138 - (39%)	Gaps:	21/138 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly  1749 FQEAAHRYQYALRKISGLEQLLER---------NAIFAQLRTNLLLNLSRCKRKLNELDASIDLA 1804
            |.|:..:.:..:.|.|..||..:|         |.|.|...||:         |...:..|.:|:
Worm    16 FDESNQQSRVGVCKHSVCEQCFDRKMSPNCPACNKIDAFKHTNI---------KFQAIAISDNLS 71

  Fly  1805 TQAIAQKPHSYEGYYARAKARMELGALNEALVDANEAMQQAAQSGVLCEVVEVLKRIQTELLTRI 1869
            .:.:....|.|:...:.:.|.......|.|.. .|:...:..:..|:..|:..||||  |.|..:
Worm    72 DEPVLSNLHRYKHVNSNSSAEQVNNTRNRATF-CNDGTHKTHKISVIENVISFLKRI--ESLNTL 133

  Fly  1870 SISSEDQT 1877
            |:.|.:.|
Worm   134 SVISPNMT 141

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
rols	NP_729778.1	zf-RING_5	327..364	CDD:291308
		Ank_5	1363..1418	CDD:290568
		ANK	1378..1503	CDD:238125
		ANK repeat	1382..1408	CDD:293786
		ANK repeat	1410..1441	CDD:293786
		Ank_2	1415..1552	CDD:289560
		ANK	1486..1609	CDD:238125
		ANK repeat	1486..1518	CDD:293786
		ANK repeat	1521..1552	CDD:293786
		Ank_2	1526..1619	CDD:289560
		ANK	1549..1675	CDD:238125
		ANK repeat	1554..1586	CDD:293786
		ANK repeat	1591..1619	CDD:293786
		Ank_2	1593..1685	CDD:289560
		ANK repeat	1621..1652	CDD:293786
		ANK repeat	1654..1685	CDD:293786
		Ank_2	1659..1735	CDD:289560
		ANK repeat	1687..1712	CDD:293786
		TPR_11	1736..1812	CDD:290150	15/71 (21%)
		TPR repeat	1736..1768	CDD:276809	4/18 (22%)
		TPR repeat	1773..1810	CDD:276809	8/36 (22%)
		TPR_11	1783..1843	CDD:290150	9/59 (15%)
		TPR repeat	1815..1843	CDD:276809	5/27 (19%)
Y38C1AA.19	NP_001294309.1	RING_Ubox	9..49	CDD:388418	7/32 (22%)
Y38C1AA.19	NP_001294309.1	RING-HC finger (C3HC4-type)	9..48	CDD:319361	7/31 (23%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1073736at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.920