powered by:
Protein Alignment rols and ZK993.2
DIOPT Version :9
Sequence 1: | NP_729778.1 |
Gene: | rols / 39368 |
FlyBaseID: | FBgn0041096 |
Length: | 1900 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001293200.1 |
Gene: | ZK993.2 / 191481 |
WormBaseID: | WBGene00022838 |
Length: | 488 |
Species: | Caenorhabditis elegans |
Alignment Length: | 56 |
Identity: | 17/56 - (30%) |
Similarity: | 28/56 - (50%) |
Gaps: | 6/56 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 327 CPSCRISFDKGKRRKLIDTCGHERCYSCMFRNDQCPMC-MNSSLKDVDGANAQGYD 381
||.|:..:|:.::|..:.:|.|..|..|. :|..|.:| :..|.:|| ...||
Worm 9 CPLCKTPYDETQKRPRLGSCHHSTCEQCQ-KNATCQICGLEDSFRDV----VYNYD 59
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1073736at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.