DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rols and ankrd63

DIOPT Version :9

Sequence 1:NP_729778.1 Gene:rols / 39368 FlyBaseID:FBgn0041096 Length:1900 Species:Drosophila melanogaster
Sequence 2:XP_012810387.1 Gene:ankrd63 / 101730682 XenbaseID:XB-GENE-6036151 Length:328 Species:Xenopus tropicalis


Alignment Length:145 Identity:49/145 - (33%)
Similarity:69/145 - (47%) Gaps:9/145 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly  1580 LLDEPLGQTRKTPLMIAA--EEGHL--ELVDLLLARGAQREAQDHEGFTALSWACLRGHLAAAKT 1640
            :::.|.|:..:||||.|.  .|..|  ..:.|||.:||...|||..|.||||.||..|||.|.|.
 Frog    40 IVNSPAGEQGRTPLMFAVCLREAELRTRFLRLLLDKGADVNAQDEAGRTALSLACELGHLDAVKL 104

  Fly  1641 LIEHGCNRHHEDHNGRTALDLAAYQGAASLVIYILEQ----GGNLEHIDVHGMRPLDRAIACRNI 1701
            |::|..:....|..|..||..||..|.:..:.::|..    |..|:..:..|:..|:.|....|.
 Frog   105 LVQHNADPELPDRAGNRALMYAASCGRSPELHFLLRSYKRFGLRLDVRNRAGVSALEAARLSGNR 169

  Fly  1702 QAVQVFL-RKGAKLG 1715
            :...... |:.||.|
 Frog   170 ECEMALSGREAAKPG 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rolsNP_729778.1 zf-RING_5 327..364 CDD:291308
Ank_5 1363..1418 CDD:290568
ANK 1378..1503 CDD:238125
ANK repeat 1382..1408 CDD:293786
ANK repeat 1410..1441 CDD:293786
Ank_2 1415..1552 CDD:289560
ANK 1486..1609 CDD:238125 10/32 (31%)
ANK repeat 1486..1518 CDD:293786
ANK repeat 1521..1552 CDD:293786
Ank_2 1526..1619 CDD:289560 15/42 (36%)
ANK 1549..1675 CDD:238125 38/98 (39%)
ANK repeat 1554..1586 CDD:293786 1/5 (20%)
ANK repeat 1591..1619 CDD:293786 13/31 (42%)
Ank_2 1593..1685 CDD:289560 37/99 (37%)
ANK repeat 1621..1652 CDD:293786 14/30 (47%)
ANK repeat 1654..1685 CDD:293786 9/34 (26%)
Ank_2 1659..1735 CDD:289560 15/62 (24%)
ANK repeat 1687..1712 CDD:293786 5/25 (20%)
TPR_11 1736..1812 CDD:290150
TPR repeat 1736..1768 CDD:276809
TPR repeat 1773..1810 CDD:276809
TPR_11 1783..1843 CDD:290150
TPR repeat 1815..1843 CDD:276809
ankrd63XP_012810387.1 ANKYR <39..171 CDD:223738 45/130 (35%)
ANK repeat 49..83 CDD:293786 13/33 (39%)
ANK repeat 85..116 CDD:293786 14/30 (47%)
ANK repeat 118..153 CDD:293786 9/34 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1073736at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.