DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pop2 and AT1G61470

DIOPT Version :9

Sequence 1:NP_001287041.1 Gene:Pop2 / 39366 FlyBaseID:FBgn0036239 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_176342.1 Gene:AT1G61470 / 842441 AraportID:AT1G61470 Length:278 Species:Arabidopsis thaliana


Alignment Length:237 Identity:83/237 - (35%)
Similarity:125/237 - (52%) Gaps:21/237 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DVWKQNLEEEFRTIRKVVQKYHYVAMDTEFPGVVAR-PVGEFRSTADYHYQLLRCNVDLLRIIQL 90
            :||:.|.:.|..:||..::..:.:|:||||||.:.. |:.   ::.:..|:.::.|||...:|||
plant     4 EVWRWNKQAEMNSIRDCLKHCNSIAIDTEFPGCLKETPMD---ASDEIRYRDMKFNVDNTHLIQL 65

  Fly    91 GLTFMDDDGKTPPGYS-TWQFNFK-FNLSEDMYAQDSIDLLQNSGIQFKKHEEDGIDPIDFAELL 153
            |||..   ||   |.: ||:.|.. ||.|:.:....||..|:|:|:...|..|:|   |...|..
plant    66 GLTLF---GK---GITKTWEINLSDFNESKSLKNDKSIAFLKNNGLDLDKIREEG---IGIEEFF 121

  Fly   154 MSSGIVLVE---NIKWLCFHSGYDFGYLLKLLTDQNLPPDESEFFDLLHIYFPN-IFDIKYLMKS 214
            |....:|.|   .::|:.|...||..||||.||.:.||....||.:.:...... ::|:|.:...
plant   122 MEFSQILNEKHGKMRWVTFQGSYDKAYLLKGLTRKPLPETSKEFDETVQQLLGRFVYDVKKMAGL 186

  Fly   215 CKNLKG--GLQEVADQLELRRVGPQHQAGSDALLTGMAFFKM 254
            |..|..  |||.:||.|::||||..|.||||:.||...|.|:
plant   187 CSGLSSRFGLQRIADVLQMRRVGKAHHAGSDSELTARVFTKL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pop2NP_001287041.1 CAF1 25..257 CDD:304961 83/237 (35%)
AT1G61470NP_176342.1 CAF1 4..243 CDD:304961 83/237 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5228
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D931256at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10797
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.