DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pop2 and AT1G27890

DIOPT Version :9

Sequence 1:NP_001287041.1 Gene:Pop2 / 39366 FlyBaseID:FBgn0036239 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_174110.1 Gene:AT1G27890 / 839682 AraportID:AT1G27890 Length:302 Species:Arabidopsis thaliana


Alignment Length:255 Identity:84/255 - (32%)
Similarity:128/255 - (50%) Gaps:33/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DVWKQNLEEEFRTIRKVVQKYHYVAMDTEFPGVVAR-PVGEFRSTADYHYQLLRCNVDLLRIIQL 90
            :||:.|.|.|..:||..::.:..:|:||||||.:.. |:.   ::.:..|:.::.|||...:|||
plant     3 EVWRWNKEVEMDSIRDCLKHFSSIAIDTEFPGCLKETPMD---ASEEIRYRDMKFNVDNTHLIQL 64

  Fly    91 GLTFMDDDGKTPPGYSTWQFNFK-FNLSEDMYAQDSIDLLQNSGIQFKKHEEDGIDP----IDFA 150
            |.|..|..|.|    .||:.|.. ||..:......||..|:::|:...|..|:||..    .||:
plant    65 GFTLFDRRGIT----KTWEINLSDFNEHKCFKNDKSIAFLKSNGLNLDKIGEEGIGIEEFFRDFS 125

  Fly   151 ELLMSSGIVLVENIKWLCFHSGYDFGYLLKLLT-DQNLPPDESEFFDLL-HIYFPNIFDIKYLMK 213
            ::|....    ..|.|:.|...||..||:|.|| .:.||..:.||.:.: .:....:||:|.:.:
plant   126 QILKEKD----GKITWVNFQGSYDNAYLVKGLTGGKPLPETKEEFHETVEQLLGKFVFDVKKIAE 186

  Fly   214 SCKNLKG--GLQEVADQLELRRVGPQHQAGSDALLTGMAFFKM------------REVQH 259
            ||..|..  |||.:||.|:::|||..|.||||:.||...|.|:            |.|.|
plant   187 SCSGLSSRFGLQRIADVLQMKRVGKAHHAGSDSELTARVFTKLTFDLLNSRKQCVRRVDH 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pop2NP_001287041.1 CAF1 25..257 CDD:304961 82/251 (33%)
AT1G27890NP_174110.1 CAF1 3..235 CDD:420020 81/242 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5228
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D931256at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10797
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.