DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pop2 and AT1G15920

DIOPT Version :9

Sequence 1:NP_001287041.1 Gene:Pop2 / 39366 FlyBaseID:FBgn0036239 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_173044.1 Gene:AT1G15920 / 838162 AraportID:AT1G15920 Length:286 Species:Arabidopsis thaliana


Alignment Length:261 Identity:125/261 - (47%)
Similarity:171/261 - (65%) Gaps:16/261 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ISGAPHAHIPSNEE--CGIRDVWKQNLEEEFRTIRKVVQKYHYVAMDTEFPGVVARPV------G 65
            :|.||:   |..|:  ..||:||..|||:|...|.:.:..:.||||||||||:|.:.|      .
plant     1 MSQAPN---PEEEDDTIEIREVWNHNLEQEMALIEQSIDDFPYVAMDTEFPGIVCKTVTANPNPN 62

  Fly    66 EFRSTADYHYQLLRCNVDLLRIIQLGLTFMDDDGKTPP----GYSTWQFNFK-FNLSEDMYAQDS 125
            .:....:|:|..|:.||::|::||||||..|:.|..|.    ....|||||: ||:..||:|.||
plant    63 PYSIHYEYNYDTLKANVNMLKLIQLGLTLSDEKGNLPTCGTNKQCIWQFNFREFNVISDMFALDS 127

  Fly   126 IDLLQNSGIQFKKHEEDGIDPIDFAELLMSSGIVLVENIKWLCFHSGYDFGYLLKLLTDQNLPPD 190
            |:||:.|.|..:|:.|.|:|...||||||.||:||.:.|.|:.||.|||||||||||:.:.||.:
plant   128 IELLRKSAIDLEKNNECGVDAKRFAELLMGSGVVLNDKIHWVTFHCGYDFGYLLKLLSGKELPEE 192

  Fly   191 ESEFFDLLHIYFPNIFDIKYLMKSCKNLKGGLQEVADQLELRRVGPQHQAGSDALLTGMAFFKMR 255
            .|:|||.:..:||.::||||||..|.||.|||:::|:.|.::|||..||||||:|||...|.||:
plant   193 ISDFFDQMEKFFPVVYDIKYLMGFCTNLYGGLEKIAELLGVKRVGISHQAGSDSLLTLRTFIKMK 257

  Fly   256 E 256
            |
plant   258 E 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pop2NP_001287041.1 CAF1 25..257 CDD:304961 120/243 (49%)
AT1G15920NP_173044.1 CAF1 16..265 CDD:420020 120/243 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 136 1.000 Domainoid score I1592
eggNOG 1 0.900 - - E1_COG5228
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 284 1.000 Inparanoid score I858
OMA 1 1.010 - - QHG54002
OrthoDB 1 1.010 - - D931256at2759
OrthoFinder 1 1.000 - - FOG0001271
OrthoInspector 1 1.000 - - otm2490
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10797
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X785
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.940

Return to query results.
Submit another query.