DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pop2 and AT1G06450

DIOPT Version :9

Sequence 1:NP_001287041.1 Gene:Pop2 / 39366 FlyBaseID:FBgn0036239 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_172133.1 Gene:AT1G06450 / 837157 AraportID:AT1G06450 Length:360 Species:Arabidopsis thaliana


Alignment Length:341 Identity:87/341 - (25%)
Similarity:154/341 - (45%) Gaps:61/341 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RDVWKQNLEEEFRTIRKVVQKYHYVAMDTEFPGVVARPVGEFRSTADYHYQLLRCNVDLLRIIQL 90
            |.||:.|::||...:.:.::::..:|.|||:||::.|..  |.|::|..|:.::.||:..::||.
plant    10 RRVWRSNVDEEMARMAECLKRFPLIAFDTEYPGIIFRTY--FDSSSDECYRAMKGNVENTKLIQC 72

  Fly    91 GLTFMDDDGKTPPGYSTWQFNF-KFNLSEDMYAQDSIDLLQNSGIQFKKHEEDGIDPID---FAE 151
            |.|..:..|:..   ..|:.|| .|....|...:.||:.|:..|:..:|..::|:|...   |.:
plant    73 GFTLFNAKGEIG---GVWEINFSNFGDPSDTRNELSIEFLRRHGLDLQKIRDEGVDMFGYGFFPK 134

  Fly   152 LLMSSGIVLVENIKWLCFHSGYDFGYLLKLLTDQNLPPDESEFFDLLHIYFPNIFDIKYLMKSCK 216
            |:  :.....::::::.|...|||.|.|.:|....||....||...:...|..::|.|.:...|:
plant   135 LM--TVFRSQKHVEFVTFQGAYDFAYFLSILNHGKLPETHGEFATEVVKVFGQVYDTKVMAGFCE 197

  Fly   217 NLKG--GLQEVADQLELRRVGPQHQAGSDALLTGMAFFKMREVQHTNDFHITPVAHDVLFRYLLE 279
            .|..  ||.::|..|::.|||..|.||||:|:|.:.|.|::.|...:.|     |..:::     
plant   198 GLGEHLGLSKLAQLLQITRVGRAHHAGSDSLMTALVFIKLKHVYEDSRF-----ARGLIY----- 252

  Fly   280 HTMNLKPTISCIHLLSRPAYNGGPAPDESAIISSGNGTGNTNSTEQFTSSAYMVTPPNTPGMAKS 344
                   .|...:|::.||    |||                           |..|..|.|.:.
plant   253 -------GIGKSNLVAAPA----PAP---------------------------VPEPTLPLMCQQ 279

  Fly   345 DAASLSNRHTSISNSF 360
            :.||....|.....::
plant   280 NVASYPVFHNGYVQNY 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pop2NP_001287041.1 CAF1 25..257 CDD:304961 70/236 (30%)
AT1G06450NP_172133.1 CAF1 10..259 CDD:304961 74/272 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5228
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D931256at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10797
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.