DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pop2 and CAF1b

DIOPT Version :9

Sequence 1:NP_001287041.1 Gene:Pop2 / 39366 FlyBaseID:FBgn0036239 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_197617.1 Gene:CAF1b / 832285 AraportID:AT5G22250 Length:278 Species:Arabidopsis thaliana


Alignment Length:250 Identity:115/250 - (46%)
Similarity:162/250 - (64%) Gaps:12/250 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IRDVWKQNLEEEFRTIRKVVQKYHYVAMDTEFPGVVARPVGEF--RSTADYHYQLLRCNVDLLRI 87
            |||||..|||.||..||.:|:.|.:::||||||||:.:...:.  |...:|.|.||:.|||.|.:
plant    14 IRDVWAYNLESEFDLIRGIVEDYPFISMDTEFPGVIYKADLDVLRRGNPNYLYNLLKSNVDALSL 78

  Fly    88 IQLGLTFMDDDGKTPP--GYST----WQFNFK-FNLSEDMYAQDSIDLLQNSGIQFKKHEEDGID 145
            ||:|||..|.||..|.  |...    |:|||: |::..|.:|.|||:||:..||.|:::..:|::
plant    79 IQVGLTLSDADGNLPDLGGQKNRRYIWEFNFRDFDVERDPHAPDSIELLRRHGIDFERNRREGVE 143

  Fly   146 PIDFAELLMSSGIVLVENIKWLCFHSGYDFGYLLKLLTDQNLPPDESEFFDLLHIYF-PNIFDIK 209
            ...||||:||||::..|::.|:.|||.||||||:|:||.:.||....||..||..:| ..::|:|
plant   144 SERFAELMMSSGLICNESVSWVTFHSAYDFGYLVKILTRRQLPVALREFLGLLRAFFGDRVYDVK 208

  Fly   210 YLMKSC-KNLKGGLQEVADQLELRR-VGPQHQAGSDALLTGMAFFKMREVQHTND 262
            ::|:.| :.|.|||..||..||:.| ||..||||||:|||..||.:||::....|
plant   209 HIMRFCEQRLYGGLDRVARSLEVNRAVGKCHQAGSDSLLTWQAFQRMRDLYFVED 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pop2NP_001287041.1 CAF1 25..257 CDD:304961 114/243 (47%)
CAF1bNP_197617.1 CAF1 14..277 CDD:420020 114/249 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5228
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54002
OrthoDB 1 1.010 - - D931256at2759
OrthoFinder 1 1.000 - - FOG0001271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10797
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X785
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.890

Return to query results.
Submit another query.