DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pop2 and CAF1a

DIOPT Version :9

Sequence 1:NP_001287041.1 Gene:Pop2 / 39366 FlyBaseID:FBgn0036239 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_190012.1 Gene:CAF1a / 823551 AraportID:AT3G44260 Length:280 Species:Arabidopsis thaliana


Alignment Length:248 Identity:111/248 - (44%)
Similarity:161/248 - (64%) Gaps:13/248 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RDVWKQNLEEEFRTIRKVVQKYHYVAMDTEFPGVVARPVGEFRSTADYHYQLLRCNVDLLRIIQL 90
            |:||.:|||.||..|.:::..|.:::||||||||:.:....|.:..|. |.||:.|||.|.:||:
plant    20 REVWAENLESEFELISEIIDDYPFISMDTEFPGVIFKSDLRFTNPDDL-YTLLKANVDALSLIQV 83

  Fly    91 GLTFMDDDGKTPP-------GYSTWQFNFK-FNLSEDMYAQDSIDLLQNSGIQFKKHEEDGIDPI 147
            |||..|.:|..|.       |: .|:|||: |:::.|.:|.|||:||:..||.|:::..||::..
plant    84 GLTLSDVNGNLPDLGDDLHRGF-IWEFNFRDFDVARDAHAPDSIELLRRQGIDFERNCRDGVESE 147

  Fly   148 DFAELLMSSGIVLVENIKWLCFHSGYDFGYLLKLLTDQNLPPDESEFFDLLHIYF-PNIFDIKYL 211
            .||||:||||:|..|.:.|:.|||.||||||:|:||.:.||....||..::.:.| ..::|:|::
plant   148 RFAELMMSSGLVCNEEVSWVTFHSAYDFGYLMKILTRRELPGALGEFKRVMRVLFGERVYDVKHM 212

  Fly   212 MKSC-KNLKGGLQEVADQLELRR-VGPQHQAGSDALLTGMAFFKMREVQHTND 262
            ||.| :.|.|||..||..||:.| ||..||||||:|||..||.:||::....|
plant   213 MKFCERRLFGGLDRVARTLEVNRAVGKCHQAGSDSLLTWHAFQRMRDLYFVQD 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pop2NP_001287041.1 CAF1 25..257 CDD:304961 110/241 (46%)
CAF1aNP_190012.1 CAF1 20..279 CDD:390100 111/248 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5228
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54002
OrthoDB 1 1.010 - - D931256at2759
OrthoFinder 1 1.000 - - FOG0001271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10797
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X785
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.890

Return to query results.
Submit another query.