DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pop2 and AT3G44240

DIOPT Version :9

Sequence 1:NP_001287041.1 Gene:Pop2 / 39366 FlyBaseID:FBgn0036239 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_190010.1 Gene:AT3G44240 / 823549 AraportID:AT3G44240 Length:239 Species:Arabidopsis thaliana


Alignment Length:222 Identity:72/222 - (32%)
Similarity:114/222 - (51%) Gaps:17/222 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IRKVVQKYHYVAMDTEFPGVVARPVGEFRSTADYHYQLLRCNVDLLRIIQLGLTFMDDDGKTPPG 104
            |...::.|.::|:|||||..:.....  .:|.:..|..:..:||..::||||||..|.:|:..  
plant     4 IEDCLRSYRFIAIDTEFPSTLRETTQ--HATDEERYMDMSFSVDRAKLIQLGLTLFDINGRIG-- 64

  Fly   105 YSTWQFNFKFNLSEDMYAQDSIDLLQNSGIQFKKHEEDGIDPID--FAELLMSSGIVLVE---NI 164
             .||:.||.....:|...:.||:.|:.:|:..:|..|:|| .|:  |:|:..    :|.:   ||
plant    65 -GTWEINFSDFGVDDARNEKSIEFLRRNGLDLRKIREEGI-RIEGFFSEMFW----MLKKTRRNI 123

  Fly   165 KWLCFHSGYDFGYLLKLLTDQNLPPDESEFFDLLHIYFPNIFDIKYLMKSCKNLKG--GLQEVAD 227
            .|:.||..||..||||..|.:.||.....|...:.....:::|:|.:...|:.|..  ||:.:|.
plant   124 TWVTFHGSYDIAYLLKGFTGEALPVTSERFSKAVARVLGSVYDLKVMAGRCEGLSSRLGLETLAH 188

  Fly   228 QLELRRVGPQHQAGSDALLTGMAFFKM 254
            :..|.|||..|.|||:..||.|.|.|:
plant   189 EFGLNRVGTAHHAGSNNELTAMVFAKV 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pop2NP_001287041.1 CAF1 25..257 CDD:304961 72/222 (32%)
AT3G44240NP_190010.1 CAF1 1..215 CDD:390100 71/220 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5228
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D931256at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10797
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.