DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pop2 and AT2G32070

DIOPT Version :9

Sequence 1:NP_001287041.1 Gene:Pop2 / 39366 FlyBaseID:FBgn0036239 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_565735.1 Gene:AT2G32070 / 817767 AraportID:AT2G32070 Length:275 Species:Arabidopsis thaliana


Alignment Length:238 Identity:136/238 - (57%)
Similarity:177/238 - (74%) Gaps:6/238 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IRDVWKQNLEEEFRTIRKVVQKYHYVAMDTEFPGVVARPVGEFRSTADYHYQLLRCNVDLLRIIQ 89
            ||:||..|||.|...||:||..:.:|||||||||:|.||||.|::..:|||:.|:.||::|::||
plant    12 IREVWNDNLESEMALIREVVDDFPFVAMDTEFPGIVCRPVGTFKTNTEYHYETLKTNVNILKMIQ 76

  Fly    90 LGLTFMDDDGKTPP-----GYSTWQFNFK-FNLSEDMYAQDSIDLLQNSGIQFKKHEEDGIDPID 148
            |||||.|:.|..|.     .|..|||||: |:|..|:||.|||:||:.|||.|.|:.|.|||...
plant    77 LGLTFSDEKGNLPTCGTDNKYCIWQFNFREFDLESDIYATDSIELLRQSGIDFVKNNEFGIDSKR 141

  Fly   149 FAELLMSSGIVLVENIKWLCFHSGYDFGYLLKLLTDQNLPPDESEFFDLLHIYFPNIFDIKYLMK 213
            ||||||||||||.||:.|:.|||||||||||||||.||||..::.||:::.:|||.::|||:|||
plant   142 FAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLPETQTGFFEMISVYFPRVYDIKHLMK 206

  Fly   214 SCKNLKGGLQEVADQLELRRVGPQHQAGSDALLTGMAFFKMRE 256
            .|.:|.|||.::|:.|::.|||..||||||:|||...|.|::|
plant   207 FCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTSCTFRKLQE 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pop2NP_001287041.1 CAF1 25..257 CDD:304961 136/238 (57%)
AT2G32070NP_565735.1 CAF1 12..275 CDD:304961 136/238 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 136 1.000 Domainoid score I1592
eggNOG 1 0.900 - - E1_COG5228
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 284 1.000 Inparanoid score I858
OMA 1 1.010 - - QHG54002
OrthoDB 1 1.010 - - D931256at2759
OrthoFinder 1 1.000 - - FOG0001271
OrthoInspector 1 1.000 - - otm2490
orthoMCL 1 0.900 - - OOG6_101138
Panther 1 1.100 - - O PTHR10797
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X785
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.