DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43896 and CG17147

DIOPT Version :9

Sequence 1:NP_001261732.1 Gene:CG43896 / 39360 FlyBaseID:FBgn0264488 Length:2113 Species:Drosophila melanogaster
Sequence 2:NP_001262099.1 Gene:CG17147 / 40216 FlyBaseID:FBgn0260393 Length:337 Species:Drosophila melanogaster


Alignment Length:405 Identity:102/405 - (25%)
Similarity:146/405 - (36%) Gaps:129/405 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 WQNLCINKTNGVFVENEANCGSYYVCSNGEATLQTCPQGSFFNTSVAAC--TVDQGNSQCWVNYC 211
            ::.||....||..|.....|..|..|.:|..|:.|||....||.|..:|  |:...|..|. |.|
  Fly    28 YEELCRLFKNGTKVRKPGTCDQYIQCYDGNGTVLTCPSNQSFNPSKGSCVDTLANSNKYCG-NRC 91

  Fly   212 IGQDDGSAVADKSNCSLFYVCSNNTATAQECPEGSYFESNNWGCVPGTCTTESPCDDSTTTTTES 276
            .|. ||..|||.:.|..::.|.|....|..||.|.:|:..:..|:.|.        ||.      
  Fly    92 EGL-DGEWVADPTECHKYFYCMNGVPLAGMCPVGQHFDERSQSCLYGV--------DSM------ 141

  Fly   277 CAEETTEPPASCDCGDIKNADFIPDEENCRKYFICIDGVLVAADCGKGNVFNANLSVCEVDADNT 341
                         |.|:.|                                     :||:.|:||
  Fly   142 -------------CVDVNN-------------------------------------ICELVAENT 156

  Fly   342 CCVADCTDGEAKV-DPQDCTKYFKC-QSGDWTSVSCDSGS----YFN-ETLNCCQVDVNNVCIDA 399
                       |. :.:||..|::| ::|:..|.||...|    ||: |:.||  |:.|.|...|
  Fly   157 -----------KFRNEKDCAYYYECDKTGNHASKSCTVTSKKREYFDVESGNC--VEANKVECTA 208

  Fly   400 KSNSTQIPTTSTVETSSVDK--------CNAKDPPASGKNCWTYQHCISGQWEDGTCPNNTYFDA 456
            .|.. .:.|:||..|...|:        |.|..|.|.....||            .||...:||.
  Fly   209 HSKE-NVCTSSTTMTFKSDQATCRGYFVCKALYPVADLDPLWT------------QCPEGYFFDE 260

  Fly   457 SVGICREDTENVCPENRSSGSRQKRSVEDCTCEGGIAQGTII--GHSTDCDKYLIC-ENGQLVEG 518
            ...:|...|..||..||              |:|   :||::  ..|.:|..|:.| :|.::.|.
  Fly   261 DRQLCANPTTVVCTHNR--------------CDG---RGTMLVTSSSNNCHNYIRCVDNKEVTEE 308

  Fly   519 VCGVGNVFQKSSGIC 533
            .|...:.|.::...|
  Fly   309 TCHWDHFFDETVEAC 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43896NP_001261732.1 CBM_14 96..147 CDD:279884
CBM_14 153..206 CDD:279884 18/54 (33%)
CBM_14 211..257 CDD:279884 16/45 (36%)
CBM_14 298..343 CDD:279884 5/44 (11%)
CBM_14 354..395 CDD:279884 16/47 (34%)
CBM_14 427..468 CDD:279884 9/40 (23%)
ChtBD2 488..535 CDD:214696 13/49 (27%)
CBM_14 544..593 CDD:279884
CBM_14 <1320..1361 CDD:279884
ChtBD2 1627..1675 CDD:214696
CBM_14 1684..1733 CDD:279884
ChtBD2 1752..1797 CDD:214696
CBM_14 1820..1868 CDD:279884
CBM_14 1896..1939 CDD:279884
ChtBD2 2046..2091 CDD:214696
CG17147NP_001262099.1 ChtBD2 <44..77 CDD:214696 11/32 (34%)
ChtBD2 89..136 CDD:214696 17/47 (36%)
CBM_14 278..332 CDD:279884 13/49 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444001
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.