DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43896 and CG7290

DIOPT Version :9

Sequence 1:NP_001261732.1 Gene:CG43896 / 39360 FlyBaseID:FBgn0264488 Length:2113 Species:Drosophila melanogaster
Sequence 2:NP_001262093.1 Gene:CG7290 / 40211 FlyBaseID:FBgn0036949 Length:419 Species:Drosophila melanogaster


Alignment Length:434 Identity:115/434 - (26%)
Similarity:173/434 - (39%) Gaps:75/434 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 AACIPDANSTCWQNLCINKTNGVFVENEANCGSYYVCSNGEATLQTCPQGSFFNTSVAACTVDQG 202
            |..|.|.|.|.   ||:..:||.:|.::::|.:||.|.....|..:||||.:|:.:...||   |
  Fly    20 APAIADVNVTA---LCLLVSNGNYVASQSDCSTYYQCQGSSFTAMSCPQGYYFDKNAQQCT---G 78

  Fly   203 N--SQCWVNY--CIGQDDGSAVADKSNCSLFYVCSNNTATAQECPEGSYFESNNWGCVPGTCTTE 263
            .  |.|..|.  |:|:..||..|..|:|..:|.|..:.|....||.|..|......||   ....
  Fly    79 TVPSTCTSNSDPCLGKAVGSFAASSSSCGGYYYCGASGAVRGNCPAGENFNPTTMACV---YKNN 140

  Fly   264 SPCDDSTTTTTESCAEETTEPPASCDCGDIKNADFIPDEENCRKYFICIDGVLVAADCGKGNVFN 328
            .||       :||..:.:|...|...|..:||..:.....:|..:..|.|.||.:..|..|.|||
  Fly   141 YPC-------SESAGDGSTVSVALNLCNLVKNGFYFGSPSDCSGWNFCQDNVLHSGSCEDGLVFN 198

  Fly   329 ANLSVCEVDADNTC-------------CVADCTDGEAKVDPQDCTKYFKCQSGDWTSVSCDSGSY 380
            ...|.|.....::|             ....|:...|.:....|.:|:.|.:|::..::|.||.|
  Fly   199 VQASNCGYKMASSCAQVTNDPSLTGVSAPTTCSSSGATIAATACNQYYLCSAGNYQLMTCPSGYY 263

  Fly   381 FNETLNCC--QVDVNNVCIDAKSNSTQIPTTSTVETSSVDKCNAKDPPASGKNCWTYQHCISG-Q 442
            ::.....|  :::..|.|      ...:.||:|.       .||    .|..||..|.:|::| |
  Fly   264 YDTISKACVTRMEARNDC------DRCVGTTATF-------VNA----YSATNCSDYLYCVNGVQ 311

  Fly   443 WEDGTCPNNTYFDASVG----------ICREDTENVCPENRSSGSRQKRSVED-CTCEGGIAQGT 496
            ....:||.|.||:.::|          :|...|::......||||....|... .|..|..:.|:
  Fly   312 KAVESCPTNYYFNENLGSCVNGLEPKFLCCNPTQSDGTSTSSSGSTSSGSTSSGSTSSGSTSSGS 376

  Fly   497 IIGHSTDCDKYLICENGQLVEGVCGVGNVFQKSSGICVPDTKAT 540
            ....||        .:|....|....|:.   |||.....|.:|
  Fly   377 TSSGST--------SSGSTSSGSTSSGST---SSGSTSSGTSST 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43896NP_001261732.1 CBM_14 96..147 CDD:279884 4/8 (50%)
CBM_14 153..206 CDD:279884 18/54 (33%)
CBM_14 211..257 CDD:279884 15/45 (33%)
CBM_14 298..343 CDD:279884 13/57 (23%)
CBM_14 354..395 CDD:279884 9/42 (21%)
CBM_14 427..468 CDD:279884 15/51 (29%)
ChtBD2 488..535 CDD:214696 10/46 (22%)
CBM_14 544..593 CDD:279884
CBM_14 <1320..1361 CDD:279884
ChtBD2 1627..1675 CDD:214696
CBM_14 1684..1733 CDD:279884
ChtBD2 1752..1797 CDD:214696
CBM_14 1820..1868 CDD:279884
CBM_14 1896..1939 CDD:279884
ChtBD2 2046..2091 CDD:214696
CG7290NP_001262093.1 CBM_14 32..77 CDD:279884 14/44 (32%)
CBM_14 91..142 CDD:279884 16/53 (30%)
CBM_14 160..207 CDD:279884 15/46 (33%)
CBM_14 234..277 CDD:279884 10/42 (24%)
ChtBD2 <296..331 CDD:214696 13/34 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444070
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.