DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43896 and obst-F

DIOPT Version :9

Sequence 1:NP_001261732.1 Gene:CG43896 / 39360 FlyBaseID:FBgn0264488 Length:2113 Species:Drosophila melanogaster
Sequence 2:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster


Alignment Length:305 Identity:71/305 - (23%)
Similarity:111/305 - (36%) Gaps:99/305 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  1627 CLGQIDGLSVPDPTDCTRFYLCLQQVPTILQSCSSGSFFDSNQGYC-RPNDGSCQ------LAIC 1684
            |||:.:|..||.|.||..::.| .:|||:|. |..|..||.|:..| .|.:.:|:      :...
  Fly    43 CLGRQEGDLVPHPLDCNGYFSC-SRVPTLLY-CDQGLQFDENRAICDLPENTNCRPVATGTVESA 105

  Fly  1685 NGLED-GKLVAHPEDCRSYYSCSSQNGTSLVQCDEGQYFHSLLSICRVDHGQCRKVSNQDETETA 1748
            |||.| .:|...|...:..:..        |....||..:.:... ..:|.:||.          
  Fly   106 NGLADNSELNWWPHKPKPVFVA--------VDVTSGQPVNPMEKY-DPEHIECRH---------- 151

  Fly  1749 PRLCYGLHGVKLPHELYCNLYYACV----------KGLA---IPVECPVQHQFNPVLSICEPESQ 1800
                ||.:  .|||...|.||:.|.          :|.|   ...||.:..|     :||..|||
  Fly   152 ----YGAY--FLPHPRNCGLYFICAYGHLHRHQCGRGTAWNFEKSECQLSDQ-----AICYGESQ 205

  Fly  1801 AVQPCSN---------GQLDGNVSYVYRCGNLQDGT----------------------------- 1827
            ..:|.::         ...:|.|:..|..|:.:..|                             
  Fly   206 ISEPHTDVETTMKVPTANSEGAVTVCYIVGSSEYTTLQQFLTSPEITELPPVTPPSPPRAEANAL 270

  Fly  1828 --------FLANRTDCTRYFICAGGVATAQRCAAGTFFDSEQLLC 1864
                    ::::..||::|:||.||:.....|..|.|:|.:...|
  Fly   271 TCPSTKQSYMSHPEDCSKYYICIGGMPVLTSCPKGLFWDQKSGFC 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43896NP_001261732.1 CBM_14 96..147 CDD:279884
CBM_14 153..206 CDD:279884
CBM_14 211..257 CDD:279884
CBM_14 298..343 CDD:279884
CBM_14 354..395 CDD:279884
CBM_14 427..468 CDD:279884
ChtBD2 488..535 CDD:214696
CBM_14 544..593 CDD:279884
CBM_14 <1320..1361 CDD:279884
ChtBD2 1627..1675 CDD:214696 20/48 (42%)
CBM_14 1684..1733 CDD:279884 9/49 (18%)
ChtBD2 1752..1797 CDD:214696 16/57 (28%)
CBM_14 1820..1868 CDD:279884 14/82 (17%)
CBM_14 1896..1939 CDD:279884
ChtBD2 2046..2091 CDD:214696
obst-FNP_649186.1 CBM_14 43..94 CDD:279884 21/52 (40%)
CBM_14 156..198 CDD:279884 12/46 (26%)
CBM_14 272..321 CDD:279884 12/44 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472921
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.