DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43896 and CG10140

DIOPT Version :9

Sequence 1:NP_001261732.1 Gene:CG43896 / 39360 FlyBaseID:FBgn0264488 Length:2113 Species:Drosophila melanogaster
Sequence 2:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster


Alignment Length:310 Identity:64/310 - (20%)
Similarity:106/310 - (34%) Gaps:54/310 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PKPLNCSSYYRCTAKNAVRTVTCAPGKEYNPKNGKCTMAGRSLCKLSLLAPLAEATNVCSTEVNG 102
            ||.|:.|.    |..:.:.|.:...|.||....|.                    .::|....:.
  Fly    21 PKDLDVSG----TTDSTLETDSTTSGLEYGLITGN--------------------LSICGNVADN 61

  Fly   103 AYIANSGSCGEFYICDEQIAYPQKCDLGSFFNETLAACIPDANSTCWQNLCINKTNGVFVENEAN 167
            .::...|.|..:|:|....|...:|:....||....:|:...::.|... | ...|......:..
  Fly    62 VFLPFVGDCNRYYLCRSGQAIELQCEWPYEFNANTQSCVHPGDADCLPT-C-EAFNFSTFSYQRT 124

  Fly   168 CGSYYVCSNGEATLQTCPQGSFFNTSVAACTVDQGNSQCWVNYCIGQDDG---SAVADKSNCSLF 229
            |..|.:|..|:..|:.|..|..:|::...|...| |..|..:.|....:.   ..|..|.:|..:
  Fly   125 CTRYVLCYYGKPVLRQCQDGLQYNSATDRCDFPQ-NVDCVESECSIYSNAYHLRYVPSKVSCQKY 188

  Fly   230 YVCSNNTATAQECPEGSYFESNNWGC-VPGTCTTESPCDD---------STTTTTESCAEETTEP 284
            ::|.|.....|.|..|.:|.:....| :|.....:.|..:         |..||...|      |
  Fly   189 FICGNGIPREQTCTAGLHFSTKCDCCDIPSKSDCQIPAVERKVQQLSRLSPVTTVGIC------P 247

  Fly   285 PASCDCGDIKNADFIPDEENCRKYFICIDGVLVAADCGKGNVFNANLSVC 334
            |:        ...|...|.....|:.|:||..:..||..|..::..:..|
  Fly   248 PS--------GVHFYVHESRRDAYYYCVDGHGLVLDCSAGLWYDPTVQEC 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43896NP_001261732.1 CBM_14 96..147 CDD:279884 10/50 (20%)
CBM_14 153..206 CDD:279884 13/52 (25%)
CBM_14 211..257 CDD:279884 11/49 (22%)
CBM_14 298..343 CDD:279884 10/37 (27%)
CBM_14 354..395 CDD:279884
CBM_14 427..468 CDD:279884
ChtBD2 488..535 CDD:214696
CBM_14 544..593 CDD:279884
CBM_14 <1320..1361 CDD:279884
ChtBD2 1627..1675 CDD:214696
CBM_14 1684..1733 CDD:279884
ChtBD2 1752..1797 CDD:214696
CBM_14 1820..1868 CDD:279884
CBM_14 1896..1939 CDD:279884
ChtBD2 2046..2091 CDD:214696
CG10140NP_648648.2 CBM_14 63..106 CDD:279884 9/42 (21%)
CBM_14 111..161 CDD:279884 13/51 (25%)
CBM_14 178..222 CDD:279884 11/43 (26%)
CBM_14 246..295 CDD:279884 13/58 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444007
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D33909at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.