DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43896 and obst-G

DIOPT Version :9

Sequence 1:NP_001261732.1 Gene:CG43896 / 39360 FlyBaseID:FBgn0264488 Length:2113 Species:Drosophila melanogaster
Sequence 2:NP_648529.1 Gene:obst-G / 39355 FlyBaseID:FBgn0036228 Length:279 Species:Drosophila melanogaster


Alignment Length:273 Identity:62/273 - (22%)
Similarity:97/273 - (35%) Gaps:76/273 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 KNADFIPDEENCRKYFICIDGVLVAADCGKGNVFNANLSVCEVDADNTCCVADCTDG-------- 350
            ||...:|...:|:.|::|.||..|...|.|..:||.....|: |.||..|:.|..|.        
  Fly    35 KNGGLLPMFGSCKGYYVCADGNAVTGTCEKNTLFNPLTLHCD-DPDNVDCIFDGKDNIVDDTSSS 98

  Fly   351 ---------EAKVDPQDCTKYFKCQSGDWTSVSCDSGSYFNETLNCCQVDVNNVCIDAKSNSTQI 406
                     .||.||.                                       :..|:.....
  Fly    99 ESDEDDDEEMAKTDPP---------------------------------------VTVKATKKPR 124

  Fly   407 PTTSTVETSSVDKCNA--KDPPASGKN--CWTYQHCISGQWEDGTCPNNTYFDASVGICREDTEN 467
            |||       :||..|  ||.....||  |..|..|.:.:....:||:..:|..:..||.:.:|.
  Fly   125 PTT-------LDKMCAGKKDGVMLTKNGSCQEYYVCKAKKPHLRSCPDKQHFSPTRRICMKASEA 182

  Fly   468 VCPENRSSGSRQKRSVEDCTCEGGIA----QGTIIGHSTDCDKYLICENGQLVEGVCGVGNVFQK 528
            .|    |.|:|:.:..:.....||:.    :.:::.|.:||.|:::|.|...:...|..|..|..
  Fly   183 KC----SGGTRENKESDGPATTGGVCSDEKENSLVAHRSDCGKFMLCSNMMFLVMDCPTGLHFNI 243

  Fly   529 SSGICVPDTKATC 541
            ::..|.....|.|
  Fly   244 ATSRCDYPKIAKC 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43896NP_001261732.1 CBM_14 96..147 CDD:279884
CBM_14 153..206 CDD:279884
CBM_14 211..257 CDD:279884
CBM_14 298..343 CDD:279884 15/44 (34%)
CBM_14 354..395 CDD:279884 2/40 (5%)
CBM_14 427..468 CDD:279884 11/42 (26%)
ChtBD2 488..535 CDD:214696 12/50 (24%)
CBM_14 544..593 CDD:279884
CBM_14 <1320..1361 CDD:279884
ChtBD2 1627..1675 CDD:214696
CBM_14 1684..1733 CDD:279884
ChtBD2 1752..1797 CDD:214696
CBM_14 1820..1868 CDD:279884
CBM_14 1896..1939 CDD:279884
ChtBD2 2046..2091 CDD:214696
obst-GNP_648529.1 CBM_14 32..83 CDD:279884 17/48 (35%)
CBM_14 132..184 CDD:279884 14/51 (27%)
CBM_14 204..256 CDD:279884 11/51 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444009
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D33909at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.