DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43896 and CG33986

DIOPT Version :9

Sequence 1:NP_001261732.1 Gene:CG43896 / 39360 FlyBaseID:FBgn0264488 Length:2113 Species:Drosophila melanogaster
Sequence 2:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster


Alignment Length:319 Identity:61/319 - (19%)
Similarity:101/319 - (31%) Gaps:107/319 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 LCINKTNGVFVENEANCGSYYVC-SNGEATLQTCPQGSFFNTSVAACTVDQGNSQCWVNYCIGQD 215
            :|.|...|.|||:..:|..:|:| .||:|.|.:||....||:....|                 |
  Fly    40 ICANHLVGEFVEHAEDCHMFYLCVENGDAVLASCPPTMLFNSESRLC-----------------D 87

  Fly   216 DGSAVADKSNCSLFYVCSNNTATAQECPEGSYFESNNWGCVPGTCTTESPCDDSTTTTTESCAEE 280
            ..:.|.          |.|.|...:..|    |:..|....|....|::....||....:..::.
  Fly    88 SATNVK----------CRNETDPIETPP----FDGGNGDGDPNNMVTDAATYCSTLVEQQQSSDR 138

  Fly   281 TTEPPASCDCGDIKNADFIPDEENCRKYFICIDGVLVAADCGKGNVFNANLSVCEVDADNTCCVA 345
            ..               ::....:||||:||..|..:..:|.....:||....|::...     |
  Fly   139 IV---------------YVGSSSSCRKYYICYYGQAILQECSSQLHWNAMTGKCDIPER-----A 183

  Fly   346 DCTDGEAKVDPQDCTKYFKCQSGDWTSVSCDSGSYFNETLNCCQVDVNNVCIDAKSNSTQIPTTS 410
            .||.|..:..|                                           .:.::..|:..
  Fly   184 QCTVGGQEDMP-------------------------------------------TNGNSGFPSGG 205

  Fly   411 TVETSSVDKCNAKDPPASGKN-------CWTYQHCISGQWEDGTCPNNTYFDASVGICR 462
            |..:|.:..|     ||.|::       |..:.:|:.|......||...:||.:...|:
  Fly   206 TAISSDLIHC-----PAYGQHLYPHMQRCEFFIYCVKGHASLQQCPFYYFFDIATKSCQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43896NP_001261732.1 CBM_14 96..147 CDD:279884
CBM_14 153..206 CDD:279884 18/53 (34%)
CBM_14 211..257 CDD:279884 8/45 (18%)
CBM_14 298..343 CDD:279884 11/44 (25%)
CBM_14 354..395 CDD:279884 1/40 (3%)
CBM_14 427..468 CDD:279884 10/43 (23%)
ChtBD2 488..535 CDD:214696
CBM_14 544..593 CDD:279884
CBM_14 <1320..1361 CDD:279884
ChtBD2 1627..1675 CDD:214696
CBM_14 1684..1733 CDD:279884
ChtBD2 1752..1797 CDD:214696
CBM_14 1820..1868 CDD:279884
CBM_14 1896..1939 CDD:279884
ChtBD2 2046..2091 CDD:214696
CG33986NP_001034017.2 CBM_14 41..92 CDD:279884 19/67 (28%)
CBM_14 141..185 CDD:279884 12/48 (25%)
ChtBD2 213..261 CDD:214696 12/52 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.