DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43896 and Mur2B

DIOPT Version :9

Sequence 1:NP_001261732.1 Gene:CG43896 / 39360 FlyBaseID:FBgn0264488 Length:2113 Species:Drosophila melanogaster
Sequence 2:NP_001284789.1 Gene:Mur2B / 31111 FlyBaseID:FBgn0025390 Length:1795 Species:Drosophila melanogaster


Alignment Length:300 Identity:76/300 - (25%)
Similarity:103/300 - (34%) Gaps:78/300 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1633 GLSVPDPTDCTRFYLCLQQVPTILQSCSSGSF---FDSNQGYCRPNDGSCQLAICNGLEDGKLVA 1694
            |...|.|.    :......|..:.:|...|.|   ||.|....|...|              :..
  Fly    53 GYQAPPPV----YQPYYDNVFGVFKSYPGGGFPVRFDYNNRCSRNYIG--------------IKP 99

  Fly  1695 HPEDCRSYYSCSSQNGTSLVQCDEGQYFHSLLSICR------VDHGQCRKVSNQDETETAPRLCY 1753
            ||:..:.||.|..       .|       .:.|.||      ...|:|.:...|...:..|..|.
  Fly   100 HPDQQQYYYVCKP-------DC-------VIFSKCRGLESFNASSGRCVQHVPQHRPDHRPPQCQ 150

  Fly  1754 GLHGVKLPHELYCNLYYACVKGLAIP--VECPVQHQFNPVLSICEPESQAVQPCSNGQLDGNVSY 1816
             ..| :.||...|.:||.|.|....|  ..||....|:||...|.|..|    |.:.::..:.||
  Fly   151 -KEG-RFPHPHDCKVYYRCDKNRTQPWLFACPAGTIFSPVERKCLPGDQ----CPSTEISDSGSY 209

  Fly  1817 VYRCGNL------QDGTFLANRTDCTRYFIC----AGG-VATAQRCAAGTFFDSEQLLCLADDGS 1870
            :.:...|      ::||| .:.|||..|:.|    :|. :.|..:|.....||.|:.||.     
  Fly   210 IPQNCELKFPECAEEGTF-RSPTDCALYYTCRLQESGTYLQTRFKCPGSNSFDLERKLCR----- 268

  Fly  1871 CPLVESVPDDDDNPNNQHVP--PDPVVCEGKHGYLMPDPA 1908
             |..| |...|..|....||  |.|        |..|.||
  Fly   269 -PRSE-VDCFDFVPGPVQVPYAPQP--------YYPPYPA 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43896NP_001261732.1 CBM_14 96..147 CDD:279884
CBM_14 153..206 CDD:279884
CBM_14 211..257 CDD:279884
CBM_14 298..343 CDD:279884
CBM_14 354..395 CDD:279884
CBM_14 427..468 CDD:279884
ChtBD2 488..535 CDD:214696
CBM_14 544..593 CDD:279884
CBM_14 <1320..1361 CDD:279884
ChtBD2 1627..1675 CDD:214696 11/44 (25%)
CBM_14 1684..1733 CDD:279884 9/54 (17%)
ChtBD2 1752..1797 CDD:214696 16/46 (35%)
CBM_14 1820..1868 CDD:279884 17/58 (29%)
CBM_14 1896..1939 CDD:279884 3/12 (25%)
ChtBD2 2046..2091 CDD:214696
Mur2BNP_001284789.1 ChtBD2 88..136 CDD:214696 13/75 (17%)
CBM_14 150..197 CDD:279884 16/48 (33%)
CBM_14 221..275 CDD:279884 19/61 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.