DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43896 and LOC105375809

DIOPT Version :9

Sequence 1:NP_001261732.1 Gene:CG43896 / 39360 FlyBaseID:FBgn0264488 Length:2113 Species:Drosophila melanogaster
Sequence 2:XP_016860927.1 Gene:LOC105375809 / 105375809 -ID:- Length:187 Species:Homo sapiens


Alignment Length:240 Identity:50/240 - (20%)
Similarity:71/240 - (29%) Gaps:94/240 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   598 PCSCGNGNVAHPICTNYFQCTDGVPQVKQCVVGEAFDSATGQCSTTVECSAKNCATASDGTTYPV 662
            ||..|:           |..|.|.|..:.|..|......:...|...:...::...|:||.    
Human     2 PCPPGS-----------FCGTSGTPATQACPSGHYCPGGSETHSGAPQACPEHTYLATDGG---- 51

  Fly   663 AGETGQFYVCLSNEATIQPCPVNTGYSA---ALGICLDQPSPDCDQTICNSAAVDSTYPSNDNDS 724
                       .::|...|||  .||..   .|....|.|.|                |.:    
Human    52 -----------HSQAECLPCP--AGYHCPWPGLSSFEDHPCP----------------PGH---- 83

  Fly   725 STFCLCRDSGAYIQSCPTGLFYDATDQVCTFSGNCDPQVCNDQSEYFVSPDYEDP--------NS 781
              :|| .|.||:.  ||.|.|......    |...|.::|        .|.|..|        |.
Human    84 --WCL-GDQGAFF--CPPGTFRSEPGA----SAQEDCELC--------PPGYHCPDPELQGHANV 131

  Fly   782 FCL-CRAGEPITVSCPIG-------------YTFNTEELECVLIP 812
            |.: |.||.    .||.|             .:.:...::|:|:|
Human   132 FAIPCPAGS----ECPAGELWPQCHCPVRPHQSSHLHLMKCILLP 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43896NP_001261732.1 CBM_14 96..147 CDD:279884
CBM_14 153..206 CDD:279884
CBM_14 211..257 CDD:279884
CBM_14 298..343 CDD:279884
CBM_14 354..395 CDD:279884
CBM_14 427..468 CDD:279884
ChtBD2 488..535 CDD:214696
CBM_14 544..593 CDD:279884
CBM_14 <1320..1361 CDD:279884
ChtBD2 1627..1675 CDD:214696
CBM_14 1684..1733 CDD:279884
ChtBD2 1752..1797 CDD:214696
CBM_14 1820..1868 CDD:279884
CBM_14 1896..1939 CDD:279884
ChtBD2 2046..2091 CDD:214696
LOC105375809XP_016860927.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.