DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14125 and Psors1c2

DIOPT Version :9

Sequence 1:NP_001261731.1 Gene:CG14125 / 39359 FlyBaseID:FBgn0036232 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001159488.1 Gene:Psors1c2 / 686254 RGDID:1591981 Length:134 Species:Rattus norvegicus


Alignment Length:135 Identity:40/135 - (29%)
Similarity:53/135 - (39%) Gaps:21/135 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 WMLMS-LQLMLLATALSARQCVKPTA-------SPKPPEDPDDPTDDPW---DPTDDSSEDPSDS 65
            |.|:. |.|.|.|..:|......|.:       ||..|..|..| .|||   .|..|  |.|...
  Rat     5 WKLLGLLVLCLFAGGISGSDDPSPKSTDTQEENSPPLPLGPPIP-GDPWPGAPPLFD--EPPPPG 66

  Fly    66 TDEPWKPTAKPTVVPTEPPSNITSTENPSEPTENPLNPTGS--PTNDEPSEPTEESTENPSDPTG 128
            ::.||:........|.:||    ||:.|..|..:...|.|:  |.|..|..| |..:|:..:|..
  Rat    67 SNRPWRDLPDSGAWPPKPP----STDPPKPPLPDDPWPAGTQPPENPWPPAP-EMDSESQEEPDL 126

  Fly   129 QPTGE 133
            .|..|
  Rat   127 DPPRE 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14125NP_001261731.1 ChtBD2 217..259 CDD:214696
Psors1c2NP_001159488.1 SPR1 24..134 CDD:292000 33/116 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMI8
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.