DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14125 and CG13615

DIOPT Version :9

Sequence 1:NP_001261731.1 Gene:CG14125 / 39359 FlyBaseID:FBgn0036232 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_651261.2 Gene:CG13615 / 42916 FlyBaseID:FBgn0039199 Length:331 Species:Drosophila melanogaster


Alignment Length:114 Identity:29/114 - (25%)
Similarity:34/114 - (29%) Gaps:38/114 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVWMLMSLQLMLLATALS---ARQCVKPTASPKPPEDPDDPTDDPWDPTDDSSEDPSDSTDEPWK 71
            ::|:.....|..|..|:.   .|...||.|...||..|..|...|                 |..
  Fly    82 LLWLAEITSLYELPAAIEDWIPRHVGKPKAKLPPPPPPPPPPPPP-----------------PPP 129

  Fly    72 PTAKPTVVPTEPPSNITSTENPSEPTENPLNPT------------GSPT 108
            |...|..||..|.|      .|.:|...||||.            |.||
  Fly   130 PPPSPPGVPANPVS------LPPQPVIVPLNPADPIQSFYFAYPQGIPT 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14125NP_001261731.1 ChtBD2 217..259 CDD:214696
CG13615NP_651261.2 DM4_12 225..320 CDD:214785
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMI8
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.