DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14125 and CG17147

DIOPT Version :10

Sequence 1:NP_001261731.1 Gene:CG14125 / 39359 FlyBaseID:FBgn0036232 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001262099.1 Gene:CG17147 / 40216 FlyBaseID:FBgn0260393 Length:337 Species:Drosophila melanogaster


Alignment Length:80 Identity:19/80 - (23%)
Similarity:32/80 - (40%) Gaps:5/80 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 PEESSGDPSDPTSATTQTIPNVDANASCRAHQGVQFLPHPYDCHLYIHCDGDIGFIKDCPSDLYW 251
            |...|.:||..:...|....|......|....| :::..|.:||.|.:|...:.....||...::
  Fly    64 PSNQSFNPSKGSCVDTLANSNKYCGNRCEGLDG-EWVADPTECHKYFYCMNGVPLAGMCPVGQHF 127

  Fly   252 NSVNQTC----DKTC 262
            :..:|:|    |..|
  Fly   128 DERSQSCLYGVDSMC 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14125NP_001261731.1 LGT <80..206 CDD:469786 5/18 (28%)
ChtBD2 217..259 CDD:214696 10/45 (22%)
CG17147NP_001262099.1 ChtBD2 <44..77 CDD:214696 4/12 (33%)
ChtBD2 89..136 CDD:214696 11/47 (23%)
CBM_14 278..332 CDD:426342
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.