DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14125 and C54D2.1

DIOPT Version :9

Sequence 1:NP_001261731.1 Gene:CG14125 / 39359 FlyBaseID:FBgn0036232 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001360717.1 Gene:C54D2.1 / 183776 WormBaseID:WBGene00016915 Length:388 Species:Caenorhabditis elegans


Alignment Length:225 Identity:56/225 - (24%)
Similarity:78/225 - (34%) Gaps:44/225 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CVKPTAS--PKPPEDPDDP-TDDPWDPTDDSSEDPSDSTDEPWKPTAKPTVVPTEPPSNITSTEN 92
            |..|...  |.|...|..| |..|..|||..:..| ::|..|.:....|::.   .|.:...|.|
 Worm   123 CALPPCHEVPVPVPVPTAPATVAPTAPTDLPTPAP-EATTTPRRLFDSPSIA---YPGDYCETTN 183

  Fly    93 -----------------PSEPTEN----PLNPTGSPTNDEPSEPTEESTENP--SDPTGQPTGET 134
                             ..|..||    |:..|.:.|....:.||...|..|  :..|.:||..|
 Worm   184 IICVGGSFCVNNVCVCREGEIIENRQCVPVATTTTTTTTTTAAPTTVITTEPTTTTTTTEPTTTT 248

  Fly   135 SNPSDQPTDSPTGQPTQETTEETKIPAGETTNEGTSDSTEEPTGEPSIPTHEPEESSGDPSDPTS 199
            :..:...|.:||...|..||        .||.|..:.:|.|.....:..|..|..:....:.|..
 Worm   249 TTTTTTTTPAPTTASTTTTT--------TTTTEAQTTTTTELATTTTTTTEAPTTTFSTTTTPAP 305

  Fly   200 ATTQTIPNVDANASCRAHQGVQFLPHPYDC 229
            .||..||...|.:  |...|..    ||:|
 Worm   306 TTTFIIPTTVAPS--REEPGCT----PYNC 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14125NP_001261731.1 ChtBD2 217..259 CDD:214696 4/13 (31%)
C54D2.1NP_001360717.1 EB <171..210 CDD:366756 6/41 (15%)
EB 336..383 CDD:366756
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMI8
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.