DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14125 and Cited4

DIOPT Version :9

Sequence 1:NP_001261731.1 Gene:CG14125 / 39359 FlyBaseID:FBgn0036232 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_446151.1 Gene:Cited4 / 114491 RGDID:620113 Length:179 Species:Rattus norvegicus


Alignment Length:180 Identity:40/180 - (22%)
Similarity:56/180 - (31%) Gaps:40/180 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 VPTEPPSNITSTENPSEPTENPLNPTGSPTNDEPSEPTEESTENPSDPTGQ-PTGETSNP-SDQP 141
            ||..|.   |....|....::.|.|.|:|.             .|..|:|. ..|...:| |.||
  Rat    16 VPHAPR---TLQPYPGPGLDSGLRPRGAPL-------------GPPPPSGTLAYGSFGSPVSFQP 64

  Fly   142 TDSPTGQP---------TQETTEETKIPAGETTNEGTSDSTEEPTGEPSIPTHEPEESSGDPSDP 197
              .|..||         :..|....::||..:...|.|.....|.....:|...|      |..|
  Rat    65 --FPVSQPPGAGNAHLQSAATPSPGRMPAPPSAAGGPSPLQPAPGAASPLPLPPP------PPLP 121

  Fly   198 TSATTQTIPNVDANA--SCRAHQG---VQFLPHPYDCHLYIHCDGDIGFI 242
            .:........:|..|  |.....|   |:.||..:.......|..|:|.:
  Rat   122 PALGCMDAELIDEEALTSLELELGLHRVRELPELFLGQSEFDCFSDLGSV 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14125NP_001261731.1 ChtBD2 217..259 CDD:214696 7/29 (24%)
Cited4NP_446151.1 CITED 1..179 CDD:282356 40/180 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..122 25/119 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMI8
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.