DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11570 and obst-E

DIOPT Version :9

Sequence 1:NP_001356902.1 Gene:CG11570 / 39357 FlyBaseID:FBgn0036230 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_723116.1 Gene:obst-E / 33806 FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster


Alignment Length:228 Identity:48/228 - (21%)
Similarity:69/228 - (30%) Gaps:72/228 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PYPN-------DCSKYYVCQKGRAYEQQCPLNLFWSQMTY---RCDYKEYSNCNTYIP-SPNHDV 104
            |.||       .|..|..||.|...|:.||..|.:.|.|.   .|.|..||.|..... .|.:..
  Fly    26 PTPNGRFASGDQCDSYTECQDGTPVEKLCPDGLLFHQRTKATGECTYAPYSTCKERARLQPANGT 90

  Fly   105 EVI---FSAYP-GDCRRFYETR--------ILRCEQNLQWSSVYQRCVVPQYGDCQNSPVTVPPV 157
            |..   |..|| ||..:....|        :.:|.:.|.::....:|..|...:..|:...:   
  Fly    91 EECPRQFGFYPNGDATKCGVYRNCAHGVASLTKCPEGLAFNEETYQCDWPDLVESCNAEAYL--- 152

  Fly   158 VPFTPLPTYPPVPTVPATVIPYDPMPTAGTPPPITPMESLPLPIDVQSLCNNSPPN--AYIPYPG 220
                                      ....|...:..:|....:||      ||..  .|..:|.
  Fly   153 --------------------------GFNCPAADSADDSAAAAVDV------SPEGELRYYRHPQ 185

  Fly   221 SCKKFIHCGPTATILSCAGSSNWNPAQHACTTY 253
            :|||:..|            .|.:|..:.|..|
  Fly   186 TCKKYFVC------------VNGHPRLYNCGKY 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11570NP_001356902.1 CBM_14 51..93 CDD:307643 18/51 (35%)
obst-ENP_723116.1 ChtBD2 23..65 CDD:214696 13/38 (34%)
CBM_14 95..146 CDD:307643 10/50 (20%)
CBM_14 180..225 CDD:307643 10/39 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.