DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11570 and CG43294

DIOPT Version :10

Sequence 1:NP_001356902.1 Gene:CG11570 / 39357 FlyBaseID:FBgn0036230 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001356903.1 Gene:CG43294 / 12798218 FlyBaseID:FBgn0262986 Length:143 Species:Drosophila melanogaster


Alignment Length:143 Identity:43/143 - (30%)
Similarity:54/143 - (37%) Gaps:36/143 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 YPGDCRRFYETRILRCEQNLQWSSVYQRCVVPQYGDCQNS--PVTVPPVVPFTPL-PTYPPVPTV 172
            :|.||.|:||||:|.|.....|:|...:|         ||  ||....:.|.|.. .:||     
  Fly    29 FPNDCHRYYETRLLDCPPEFYWNSQLLQC---------NSQTPVGCSSIDPITNWNNSYP----- 79

  Fly   173 PATVIPYDPMPTAGTPPPITPMESLPLPIDVQSLCNNSPPNAYIPYPGSCKKFIHCGPTATILSC 237
                          ..|||...|:    .|:..||.|. .|..||||..|.|||.|.....::.|
  Fly    80 --------------NSPPIKEPEN----SDLTKLCENK-LNQLIPYPADCTKFIRCDYLPFVMCC 125

  Fly   238 AGSSNWNPAQHAC 250
            .....||.....|
  Fly   126 PQYLYWNSQLLTC 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11570NP_001356902.1 CBM_14 51..93 CDD:426342
CG43294NP_001356903.1 ChtBD2 96..139 CDD:214696 16/44 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.