DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7248 and CG7017

DIOPT Version :9

Sequence 1:NP_648530.1 Gene:CG7248 / 39356 FlyBaseID:FBgn0036229 Length:796 Species:Drosophila melanogaster
Sequence 2:NP_001262095.1 Gene:CG7017 / 40213 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster


Alignment Length:401 Identity:93/401 - (23%)
Similarity:136/401 - (33%) Gaps:105/401 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 CEDQEKGTFFPDPENCQQYYYCWGNKSYTILP---CPVDNWFNPISGNCGPDIAPDACRETTPTS 268
            |:...:.|.|..|..|..:..|..|  |::|.   |.....:|...|.|                
  Fly    33 CDLLPQETSFLRPNTCDNWVRCASN--YSVLEQGGCAAGLNYNKELGRC---------------- 79

  Fly   269 TPTIDTSSSTTVAP--TSTEDSVGNPCADQELGASF--PIKSDCQSYLLCLNNGESTTAKCPSNA 329
               |..|||..|.|  .|..|...|.||::..||..  |..|||:.|:||.:: :...|.||:..
  Fly    80 ---ILASSSAAVCPYADSIADKATNLCANETEGAFIVDPSSSDCRGYILCKSH-KQIKANCPNEL 140

  Fly   330 WFDPKTGDCGPNVSPTACLESFETTTTAVTTQAPKDPCADQELGTSYPLV--TNCQQYILCMGNG 392
            .|.|.:..|           .:|.......:|..|...|.:.|..:..|.  .:|.||..|:...
  Fly   141 IFHPVSRSC-----------VYEKQYRCPISQTKKTSPACRSLPNNTRLADPVHCDQYYECVSEV 194

  Fly   393 ESTVANCIYNSWFDPQTGNCGPDVSPTACKESGVTTASPTTTSQATSPLTTPSPTWSTLPTANTE 457
            ..:.| |...|.:|...|.| .||:..:|.||              :.|..|..|:..       
  Fly   195 LHSRA-CPVASAYDANLGYC-VDVAEVSCYES--------------AALPEPENTFCL------- 236

  Fly   458 ETTTNPPDIVGICSGESDGYYATYPEVCNKYILCASPV-------PIAFYCPESLFFNEALQRCV 515
            ::.|....:         ||:|. .|.|:.|.:|.|||       |....||...:|:.....|.
  Fly   237 DSATGSARV---------GYFAD-DESCSHYYICGSPVAGKHDTEPKHLSCPLGQYFDFEKLSCR 291

  Fly   516 EWESSDCSNGETTTSSPGFTTPSPDTQICSNSTGLNLPYQE---NCQWYIYCTDENSYMMGICGS 577
            :..:..|.                    .....|.|:.|..   :||.|..|:...:..:|.|.:
  Fly   292 DRLNVRCQ--------------------LDRCVGTNITYVNVAGDCQSYGRCSGGVTVSLGQCPT 336

  Fly   578 EEYFDPWTGKC 588
            ..|||.....|
  Fly   337 GYYFDERNQGC 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7248NP_648530.1 CBM_14 62..113 CDD:279884
CBM_14 136..182 CDD:279884
CBM_14 207..261 CDD:279884 13/56 (23%)
CBM_14 293..347 CDD:279884 17/55 (31%)
CBM_14 367..421 CDD:279884 15/55 (27%)
CBM_14 470..522 CDD:279884 15/58 (26%)
CBM_14 544..597 CDD:279884 13/48 (27%)
CBM_14 630..678 CDD:279884
CBM_14 710..758 CDD:279884
CG7017NP_001262095.1 CBM_14 103..155 CDD:279884 18/63 (29%)
ChtBD2 246..290 CDD:214696 14/44 (32%)
CBM_14 303..348 CDD:279884 13/45 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443995
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.