DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7248 and CG10140

DIOPT Version :9

Sequence 1:NP_648530.1 Gene:CG7248 / 39356 FlyBaseID:FBgn0036229 Length:796 Species:Drosophila melanogaster
Sequence 2:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster


Alignment Length:359 Identity:82/359 - (22%)
Similarity:113/359 - (31%) Gaps:91/359 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   421 CKESGVTTASPTTTSQATSPLTTPSPTWSTLPTANTEE------TTTNPPDIVGICSGESDGYYA 479
            |...||..|.|       ..|.....|.|||.|.:|..      .|.|    :.||...:|..:.
  Fly    11 CIFCGVFGARP-------KDLDVSGTTDSTLETDSTTSGLEYGLITGN----LSICGNVADNVFL 64

  Fly   480 TYPEVCNKYILCASPVPIAFYCPESLFFNEALQRCVEWESSDCSNGETTTSSPGFTTPSPDTQIC 544
            .:...||:|.||.|...|...|.....||...|.||....:||.   .|..:..|:|.|      
  Fly    65 PFVGDCNRYYLCRSGQAIELQCEWPYEFNANTQSCVHPGDADCL---PTCEAFNFSTFS------ 120

  Fly   545 SNSTGLNLPYQENCQWYIYCTDENSY----MMGICGSEEYFDPWTGKCGFGVSPEACREIQTTSP 605
                     ||..|..|:.|     |    ::..|.....::..|.:|.|              |
  Fly   121 ---------YQRTCTRYVLC-----YYGKPVLRQCQDGLQYNSATDRCDF--------------P 157

  Fly   606 TVTDSTEGPTTVITPSTPGSEPDPCDGAPEGKLVPYPDDCSKFIQCIQPDPIVYDCREGQEFSAA 670
            ...|..|...::.:            .|...:.||....|.|:..|....|....|..|..||..
  Fly   158 QNVDCVESECSIYS------------NAYHLRYVPSKVSCQKYFICGNGIPREQTCTAGLHFSTK 210

  Fly   671 LERCMAPWFANCSIPA--------TTIPPVTIPTTTTTTEKPSPNGICADKAEGSLVPYPGNCSK 727
            .:.|..|..::|.|||        :.:.|||..            |||........| :......
  Fly   211 CDCCDIPSKSDCQIPAVERKVQQLSRLSPVTTV------------GICPPSGVHFYV-HESRRDA 262

  Fly   728 YIACEDPIPVGYACPEGEEFNPIILTCTDPHLAG 761
            |..|.|...:...|..|..::|.:..|.:|...|
  Fly   263 YYYCVDGHGLVLDCSAGLWYDPTVQECREPQNVG 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7248NP_648530.1 CBM_14 62..113 CDD:279884
CBM_14 136..182 CDD:279884
CBM_14 207..261 CDD:279884
CBM_14 293..347 CDD:279884
CBM_14 367..421 CDD:279884 82/359 (23%)
CBM_14 470..522 CDD:279884 15/51 (29%)
CBM_14 544..597 CDD:279884 10/56 (18%)
CBM_14 630..678 CDD:279884 12/47 (26%)
CBM_14 710..758 CDD:279884 9/47 (19%)
CG10140NP_648648.2 CBM_14 63..106 CDD:279884 13/42 (31%)
CBM_14 111..161 CDD:279884 14/83 (17%)
CBM_14 178..222 CDD:279884 12/43 (28%)
CBM_14 246..295 CDD:279884 10/49 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444047
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D33909at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.