DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7248 and CG5897

DIOPT Version :9

Sequence 1:NP_648530.1 Gene:CG7248 / 39356 FlyBaseID:FBgn0036229 Length:796 Species:Drosophila melanogaster
Sequence 2:NP_001356901.1 Gene:CG5897 / 39346 FlyBaseID:FBgn0036220 Length:343 Species:Drosophila melanogaster


Alignment Length:403 Identity:91/403 - (22%)
Similarity:131/403 - (32%) Gaps:121/403 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 EDQEK---GT-FFPDPENCQQYYYCWGNKSYTILPCPVDNWFNPISGNCGPDIAPDACRETTPTS 268
            ||:.|   || :..||.:||.:.||..||......|.....::...|.|             ..:
  Fly    26 EDKCKLWAGTGYIGDPSDCQAWGYCQDNKLIDRRSCTEGLLYSFRDGTC-------------KRA 77

  Fly   269 TPTIDTSS-STTVAPTSTEDSVGNPCADQELGASFPIKSDCQSYLLCLNNGESTTAKCPSNAWFD 332
            :.||..|. |...|.....:.|.||             :||:.::.|.:..             |
  Fly    78 SDTICHSQLSEICASLEPWNYVANP-------------ADCRRFVKCADLD-------------D 116

  Fly   333 PKTGDCG-----PNVSPTACLESFETTTTAVTTQAPKDP-CADQELGTSYPLVTNCQQYILCMGN 391
            |..||||     .|...| |||.        ....|:|. |:..:.|:......:||.|..| .|
  Fly   117 PTWGDCGVGQVFSNKKQT-CLEE--------VAGCPQDNICSHMKDGSFVGDPKSCQIYYKC-HN 171

  Fly   392 GESTVANCIYNSWFDPQTGNCGPDVSPTACKESGVTTASPTTTSQATSPLTTPSPTWSTLPTANT 456
            |..|:.||....:|:.:|||| ....|..|.:                               :.
  Fly   172 GFGTMLNCSVGRYFNRKTGNC-QSWMPHYCSK-------------------------------DD 204

  Fly   457 EETTTNPPDI-VGICS----GESDGYYATYPEV--CNKYILCASPVPIAFY--CPESLFFNEALQ 512
            |:....||.. ..|||    .:.|| ....|::  |..|..|.|...:..:  ||..|.|....|
  Fly   205 EDNILTPPSTDHNICSKYYQRDRDG-VQLLPDLMTCYGYYSCTSQFDVGKWSSCPWGLHFEWWSQ 268

  Fly   513 RCVEWESSDCSNGETTTSSPGFTTPSPDTQICSNSTGLNL-PYQENCQWYIYCTDENSYMMGICG 576
            ||...:.:.||...                 |:|...|.: .....|:.:..|.|..|.....|.
  Fly   269 RCGSPKDNSCSYDR-----------------CANRNQLMVATINTGCREFTICQDNRSKSSQKCP 316

  Fly   577 SE-EYFDPWTGKC 588
            .: .||:....:|
  Fly   317 EDYPYFNELLRQC 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7248NP_648530.1 CBM_14 62..113 CDD:279884
CBM_14 136..182 CDD:279884
CBM_14 207..261 CDD:279884 16/56 (29%)
CBM_14 293..347 CDD:279884 11/58 (19%)
CBM_14 367..421 CDD:279884 17/53 (32%)
CBM_14 470..522 CDD:279884 16/59 (27%)
CBM_14 544..597 CDD:279884 11/47 (23%)
CBM_14 630..678 CDD:279884
CBM_14 710..758 CDD:279884
CG5897NP_001356901.1 ChtBD2 146..192 CDD:214696 14/46 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444092
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.