DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7248 and CG33986

DIOPT Version :9

Sequence 1:NP_648530.1 Gene:CG7248 / 39356 FlyBaseID:FBgn0036229 Length:796 Species:Drosophila melanogaster
Sequence 2:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster


Alignment Length:220 Identity:60/220 - (27%)
Similarity:95/220 - (43%) Gaps:39/220 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 AENCNEFYLCV-NDQSKVYRCPGEMLFNPDLNICDDKDNVWCYGDRTTPDPLDT----------- 196
            ||:|:.||||| |..:.:..||..||||.:..:||...||.|   |...||::|           
  Fly    53 AEDCHMFYLCVENGDAVLASCPPTMLFNSESRLCDSATNVKC---RNETDPIETPPFDGGNGDGD 114

  Fly   197 -----TTPAEESFTKCEDQEKG---TFFPDPENCQQYYYCWGNKSYTILPCPVDNWFNPISGNCG 253
                 |..|....|..|.|:..   .:.....:|::||.|:..:: .:..|.....:|.::|.| 
  Fly   115 PNNMVTDAATYCSTLVEQQQSSDRIVYVGSSSSCRKYYICYYGQA-ILQECSSQLHWNAMTGKC- 177

  Fly   254 PDIAPDA-C----RETTPTSTPTIDTSSSTTVAPTSTEDSVGNPCADQELGASFPIKSDCQSYLL 313
             ||...| |    :|..||:..:...|..|.:    :.|.:..|...|.|   :|....|:.::.
  Fly   178 -DIPERAQCTVGGQEDMPTNGNSGFPSGGTAI----SSDLIHCPAYGQHL---YPHMQRCEFFIY 234

  Fly   314 CLNNGESTTAKCPSNAWFDPKTGDC 338
            |: .|.::..:||...:||..|..|
  Fly   235 CV-KGHASLQQCPFYYFFDIATKSC 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7248NP_648530.1 CBM_14 62..113 CDD:279884
CBM_14 136..182 CDD:279884 17/38 (45%)
CBM_14 207..261 CDD:279884 13/57 (23%)
CBM_14 293..347 CDD:279884 12/46 (26%)
CBM_14 367..421 CDD:279884
CBM_14 470..522 CDD:279884
CBM_14 544..597 CDD:279884
CBM_14 630..678 CDD:279884
CBM_14 710..758 CDD:279884
CG33986NP_001034017.2 CBM_14 41..92 CDD:279884 17/38 (45%)
CBM_14 141..185 CDD:279884 11/46 (24%)
ChtBD2 213..261 CDD:214696 13/50 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.