DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7248 and CG32302

DIOPT Version :9

Sequence 1:NP_648530.1 Gene:CG7248 / 39356 FlyBaseID:FBgn0036229 Length:796 Species:Drosophila melanogaster
Sequence 2:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster


Alignment Length:342 Identity:66/342 - (19%)
Similarity:112/342 - (32%) Gaps:114/342 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 ENPCLGTRNNTLLPS--AENCNEFYLCVNDQS------KVYRCPGEMLFNPDLNICDDKDNVWCY 185
            :|||...|    :|.  ..||.....|:.|.:      .:..|..|..|     .|.|:....| 
  Fly    23 DNPCQDVR----IPGFVCMNCTTLGYCIRDATGSWETISMLGCQSEYNF-----YCSDEGTFGC- 77

  Fly   186 GDRTTPDPLDTTTPAEESF-TKCEDQEKGTF-------FPDPENCQQYYYCWGNKSYTILPCPVD 242
                             :| ::|:..::|.|       ||||.:|::|:.|......|...|...
  Fly    78 -----------------TFQSQCQVPKRGPFSCQQAGLFPDPYDCRRYHECSDQSVDTPRICSNG 125

  Fly   243 NWFNPISGNCGPDIAPDACRETTPTSTPTIDTSSSTTVAPTSTEDSVGNPCADQELGASFPIKSD 307
            ..::.::|.|   :.|   ||:..........|.|..|...:.::.....|.:....:.:|:...
  Fly   126 AGYSTLTGTC---VLP---RESEQCIQEQFTCSRSGQVGGWAPDNRYFYVCVNDTANSLYPLMMK 184

  Fly   308 C------QSYL-----------------LCLNN-------------------GESTTAKCPSNAW 330
            |      .||.                 .|:||                   ||.....||:...
  Fly   185 CHEGFVFNSYSCVPDTRSMRSIQAMESHTCMNNDRYQCPFRTSEIEYCKCVDGELEVMTCPAGFQ 249

  Fly   331 FDPKTGDCGPNVSPTACLESFETTTTAVTTQAPKDPCADQELGTSYPLVTNCQQYILCMGNGEST 395
            .|||                   ..|.||.:..:  |:|.|: .|.|.|:...:|.:|:.: :..
  Fly   250 IDPK-------------------ILTCVTDRIYQ--CSDFEI-LSCPNVSTKDEYCICIDH-QLQ 291

  Fly   396 VANCIYNSWFDPQTGNC 412
            :.:|....:|:.:|..|
  Fly   292 IYSCPMGQYFNAETRKC 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7248NP_648530.1 CBM_14 62..113 CDD:279884
CBM_14 136..182 CDD:279884 11/53 (21%)
CBM_14 207..261 CDD:279884 15/60 (25%)
CBM_14 293..347 CDD:279884 15/95 (16%)
CBM_14 367..421 CDD:279884 12/46 (26%)
CBM_14 470..522 CDD:279884
CBM_14 544..597 CDD:279884
CBM_14 630..678 CDD:279884
CBM_14 710..758 CDD:279884
CG32302NP_728732.1 CBM_14 94..144 CDD:279884 14/55 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444045
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.