DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7248 and CG13806

DIOPT Version :9

Sequence 1:NP_648530.1 Gene:CG7248 / 39356 FlyBaseID:FBgn0036229 Length:796 Species:Drosophila melanogaster
Sequence 2:NP_647708.1 Gene:CG13806 / 38292 FlyBaseID:FBgn0035325 Length:297 Species:Drosophila melanogaster


Alignment Length:371 Identity:81/371 - (21%)
Similarity:108/371 - (29%) Gaps:152/371 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   449 STLPTANTEETTTNPPDIVGICSGESDGYYATYPEVCNKYILCASPVPIAFYCPESLFFNEALQR 513
            :|:.|...:...||.      |.|..                  ||.||...|       |.|..
  Fly    22 ATVTTRRIQPRETNS------CEGRQ------------------SPGPICESC-------ELLAT 55

  Fly   514 CVE----W-----ESSDCSNGETTTSSPGFTTPSPDTQICSNSTGLNLPY--------------- 554
            ||.    |     ||.|.:||....:..|         .|:|.||...|:               
  Fly    56 CVRHSNGWVNIPVESCDVANGYYCNARLG---------SCTNETGPCHPFGIEGNFQCTSQGIFP 111

  Fly   555 -QENCQWYIYCTDENSYMMGI--------CGSEEYFDPWTGKCGFGVSPEACREIQTTSPTVTDS 610
             ..:||.|..|     |.:|.        ||:::.||..||:|...::...|.:.|...|.....
  Fly   112 DPYDCQKYHMC-----YFVGATLVAAAVDCGNDKAFDATTGQCTLTLTDSVCLQRQYYCPNAGHV 171

  Fly   611 TEGPTT----VITPSTPGSEPDPCDGAPEGKLVPYP-----DDCSKFIQCIQPDPIVYDCREGQE 666
            ...||.    .:..||.....:       ..:|.||     :|...|:.        |.||.|  
  Fly   172 AAWPTNPNIFYVCKSTVNQNLN-------DTIVIYPSLHRCNDGETFVD--------YVCRSG-- 219

  Fly   667 FSAALERCMAPWFANCSIPATTIPPVTIPTTTTTTEKPSPN-----GICADKAEGSLVPYPGN-C 725
                         :|...|:|..|.|.|...........||     |:.||          || |
  Fly   220 -------------SNVLPPSTDDPSVIIEDPNDDDFSVLPNTCQHVGLMAD----------GNDC 261

  Fly   726 SKYIACE---------DPIPVGYACPEGEEFNPIILTCTDPHLAGC 762
            .||..|.         |       ||.|..:.|.:.:|.   |..|
  Fly   262 RKYYYCSALNGTLRHMD-------CPNGTYYRPELSSCV---LGSC 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7248NP_648530.1 CBM_14 62..113 CDD:279884
CBM_14 136..182 CDD:279884
CBM_14 207..261 CDD:279884
CBM_14 293..347 CDD:279884
CBM_14 367..421 CDD:279884
CBM_14 470..522 CDD:279884 14/60 (23%)
CBM_14 544..597 CDD:279884 18/76 (24%)
CBM_14 630..678 CDD:279884 9/52 (17%)
CBM_14 710..758 CDD:279884 14/57 (25%)
CG13806NP_647708.1 CBM_14 105..158 CDD:279884 13/57 (23%)
ChtBD2 247..293 CDD:214696 15/62 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443980
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.