DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7248 and obst-A

DIOPT Version :9

Sequence 1:NP_648530.1 Gene:CG7248 / 39356 FlyBaseID:FBgn0036229 Length:796 Species:Drosophila melanogaster
Sequence 2:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster


Alignment Length:237 Identity:57/237 - (24%)
Similarity:88/237 - (37%) Gaps:46/237 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 CVVSSQQNSTYCESLSNGFYEYPYNCSAYITCYDSCADLEYCPDGKLF---NSPLQICDTPGAVD 112
            ||.::...:.:.....||.:.....|..:..|.|..|..:.||||.:|   |.....||.|..||
  Fly    13 CVATTVSAANFECPKPNGQFADEVQCDKFYVCDDGVAKAKLCPDGLVFDPLNRKFNKCDQPFNVD 77

  Fly   113 CEPLPYPTPSPTE-SPPENPCLGTRNNTLL--PSAENCNEFYLCVNDQSKVYRCPGEMLFNPDLN 174
            ||       ..|| ..|::.....|.|...  |....||.||.|:...:...:|...:.|:....
  Fly    78 CE-------DRTELQEPKSSKYCPRKNGFFAHPDPAVCNIFYNCIEGDALETKCTVGLHFDEYSG 135

  Fly   175 ICDDKDNVW--------CYGDRTTPDPLDTTTPAEESFTKCEDQ----EKGTF-----FPDPENC 222
            .|     ||        |..::.|         :|..|...:||    ::|..     :|.|.:|
  Fly   136 TC-----VWPDTAKREGCNPEQRT---------SETGFVCPKDQPKTDDRGQVVTHPKYPHPTDC 186

  Fly   223 QQYYYCWGNKSYTILPCPVDNWFNPISGNC-GPDIAPDACRE 263
            |::|.|...:....|.|.:...:|..:..| .|:..| .|.:
  Fly   187 QKFYVCLNGEDPRDLGCQLGEVYNDATEMCDAPENVP-GCED 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7248NP_648530.1 CBM_14 62..113 CDD:279884 16/53 (30%)
CBM_14 136..182 CDD:279884 11/47 (23%)
CBM_14 207..261 CDD:279884 15/63 (24%)
CBM_14 293..347 CDD:279884
CBM_14 367..421 CDD:279884
CBM_14 470..522 CDD:279884
CBM_14 544..597 CDD:279884
CBM_14 630..678 CDD:279884
CBM_14 710..758 CDD:279884
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 15/49 (31%)
CBM_14 95..143 CDD:366726 13/52 (25%)
CBM_14 180..225 CDD:366726 12/45 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443994
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.