DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7248 and CG34324

DIOPT Version :9

Sequence 1:NP_648530.1 Gene:CG7248 / 39356 FlyBaseID:FBgn0036229 Length:796 Species:Drosophila melanogaster
Sequence 2:NP_001096972.1 Gene:CG34324 / 32302 FlyBaseID:FBgn0085353 Length:267 Species:Drosophila melanogaster


Alignment Length:311 Identity:69/311 - (22%)
Similarity:85/311 - (27%) Gaps:91/311 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 DTPGAVDCEPLPYPTPSPTESPPENPCLGTRNNTLLPSAENCNEFYLCVNDQSKVYRCPGEMLFN 170
            |||   .|.|.|.|. :.|..||..||  |......|....|.           ...||     .
  Fly    30 DTP---PCTPPPDPC-TTTTCPPPPPC--TTTTCPPPEPPPCT-----------TTTCP-----P 72

  Fly   171 PDLNICDDKDNVWCYGDRTTPDPLDTTT----PAEESFTKCEDQEKGTFFPDPENCQQYYYCWGN 231
            |:                  |.|..|||    |.....|.|.........|.|..|.:       
  Fly    73 PE------------------PPPCTTTTCPPPPPPCITTTCPPPPPPPPPPPPPPCTR------- 112

  Fly   232 KSYTILPCPVDNWFNPISGNCGPDIAPDACRETTPTSTPTIDTSSSTTVAPTSTEDSVGNPCADQ 296
               |..||               ...|..|..|.|..|.|....:.|....|.|.     ||.  
  Fly   113 ---TPPPC---------------TRTPPPCTRTPPPCTRTPPPCTRTPPPCTRTP-----PCT-- 152

  Fly   297 ELGASFPIKSDCQSYLLCLNNGESTTAKCPSNAWFDPKTGDCGPNVSPTACLESFETTTTAVTTQ 361
               .:.|....|           :||..|.:.....||:.:.||.|.........:.........
  Fly   153 ---TTPPCTPPC-----------TTTKPCTTTVCTTPKSDNAGPIVDGNEEQPDIDNPVAIAQVL 203

  Fly   362 APKDPCADQELGTSYPLVTNCQQYILCMGNGESTVANCIYNSWFDPQTGNC 412
            ..:..|..||.||....|.:|::|.:| ....|...||....|||.:...|
  Fly   204 ISRHDCRGQEDGTFLADVRHCRRYYVC-NRQRSKRQNCPNGYWFDRELKAC 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7248NP_648530.1 CBM_14 62..113 CDD:279884 3/6 (50%)
CBM_14 136..182 CDD:279884 5/45 (11%)
CBM_14 207..261 CDD:279884 8/53 (15%)
CBM_14 293..347 CDD:279884 11/53 (21%)
CBM_14 367..421 CDD:279884 16/46 (35%)
CBM_14 470..522 CDD:279884
CBM_14 544..597 CDD:279884
CBM_14 630..678 CDD:279884
CBM_14 710..758 CDD:279884
CG34324NP_001096972.1 CBM_14 209..262 CDD:279884 16/46 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.