Sequence 1: | NP_648530.1 | Gene: | CG7248 / 39356 | FlyBaseID: | FBgn0036229 | Length: | 796 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_728731.1 | Gene: | obst-I / 317966 | FlyBaseID: | FBgn0052304 | Length: | 219 | Species: | Drosophila melanogaster |
Alignment Length: | 206 | Identity: | 54/206 - (26%) |
---|---|---|---|
Similarity: | 80/206 - (38%) | Gaps: | 47/206 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 CVVSSQQNSTYCESLSNGFYEYPYNCSAYITCYDSCADLEYCPDGKLFNSPLQICDTPGAVDCEP 115
Fly 116 LPYPTPSPTESPPENPCLGTRNNTLLPSAENCNEFYLCVNDQSKVYRCPGEMLFNPDLNICDDKD 180
Fly 181 NVWCYGDRTTPDPLDTTTPAEE---SFTKCEDQEKGTFFPDPENCQQYYYCWGNKS-YTILPCPV 241
Fly 242 DNWFNPISGNC 252 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7248 | NP_648530.1 | CBM_14 | 62..113 | CDD:279884 | 11/50 (22%) |
CBM_14 | 136..182 | CDD:279884 | 10/45 (22%) | ||
CBM_14 | 207..261 | CDD:279884 | 18/47 (38%) | ||
CBM_14 | 293..347 | CDD:279884 | |||
CBM_14 | 367..421 | CDD:279884 | |||
CBM_14 | 470..522 | CDD:279884 | |||
CBM_14 | 544..597 | CDD:279884 | |||
CBM_14 | 630..678 | CDD:279884 | |||
CBM_14 | 710..758 | CDD:279884 | |||
obst-I | NP_728731.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D487374at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |