DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7248 and obst-I

DIOPT Version :9

Sequence 1:NP_648530.1 Gene:CG7248 / 39356 FlyBaseID:FBgn0036229 Length:796 Species:Drosophila melanogaster
Sequence 2:NP_728731.1 Gene:obst-I / 317966 FlyBaseID:FBgn0052304 Length:219 Species:Drosophila melanogaster


Alignment Length:206 Identity:54/206 - (26%)
Similarity:80/206 - (38%) Gaps:47/206 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 CVVSSQQNSTYCESLSNGFYEYPYNCSAYITCYDSCADLEYCPDGKLFNSPLQICDTPGAVDCEP 115
            ||   ..::|.|.:...|..........:..|.|....:..||:|..|::...:|.. |:|:|:.
  Fly    52 CV---STDTTSCTNHQIGKCPMATEMDEFCVCKDKHLQIWKCPEGTYFDANRLVCRV-GSVECQD 112

  Fly   116 LPYPTPSPTESPPENPCLGTRNNTLLPSAENCNEFYLCVNDQSKVYRCPGEMLFNPDLNICDDKD 180
             .| |||        ||         |::...:.|.||::.:..:..||....|:.:|.||    
  Fly   113 -DY-TPS--------PC---------PNSTASDVFCLCIDGKWHLNYCPTGFTFDDELQIC---- 154

  Fly   181 NVWCYGDRTTPDPLDTTTPAEE---SFTKCEDQEKGTFFPDPENCQQYYYCWGNKS-YTILPCPV 241
                         |:|.:..:|   |..||  |..| .|.||.:|..||:|....| .....|.|
  Fly   155 -------------LNTGSDDDELPSSSGKC--QRLG-LFGDPADCSGYYHCREKGSDIEYFRCSV 203

  Fly   242 DNWFNPISGNC 252
            ...||.||..|
  Fly   204 GTIFNLISFAC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7248NP_648530.1 CBM_14 62..113 CDD:279884 11/50 (22%)
CBM_14 136..182 CDD:279884 10/45 (22%)
CBM_14 207..261 CDD:279884 18/47 (38%)
CBM_14 293..347 CDD:279884
CBM_14 367..421 CDD:279884
CBM_14 470..522 CDD:279884
CBM_14 544..597 CDD:279884
CBM_14 630..678 CDD:279884
CBM_14 710..758 CDD:279884
obst-INP_728731.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.