DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7248 and CG33263

DIOPT Version :9

Sequence 1:NP_648530.1 Gene:CG7248 / 39356 FlyBaseID:FBgn0036229 Length:796 Species:Drosophila melanogaster
Sequence 2:NP_996072.1 Gene:CG33263 / 2768952 FlyBaseID:FBgn0053263 Length:227 Species:Drosophila melanogaster


Alignment Length:243 Identity:57/243 - (23%)
Similarity:90/243 - (37%) Gaps:41/243 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 TSTEDSVGNPCADQELGASFPIKSDCQSYLLCLNNGE-STTAKCPSNAWFDPKTGDCGPNVSPTA 346
            ||.|..|...||:..|........||.||:.|  ||| |....||.:.:||.:|.:|..: ....
  Fly    18 TSIEAEVFPQCANAPLDTFVMAIEDCASYIYC--NGEDSFRDSCPESTYFDDRTQECAFD-DEGV 79

  Fly   347 CLESFETTTTAVTTQAPKDPCADQELG--TSYPLVTNCQQYILCMGNGESTVANCIYNSWFDPQT 409
            ||.:.::..|  ..|..|....:::.|  .:.|:.|                          |.:
  Fly    80 CLRNSDSVQT--EEQPDKQTTGEEQSGIEETTPVPT--------------------------PPS 116

  Fly   410 GNCGPDVSPTACKESGVTTASPTTTSQATSPLTTPSPTWSTLPTANTEETTTNPPDIVGICSGES 474
                 |.:.|...:|....|..|||...:.|..|..||.|..|::.:.: .::|......|....
  Fly   117 -----DYASTGSADSSTFQADSTTTPTESIPSVTEPPTTSATPSSPSAK-PSSPAQERPHCDISG 175

  Fly   475 DGYYATYPEVCNKYILCASPVPIAFYCPESLFFNEALQRCVEWESSDC 522
            ||.: .:|:.|..|..|.|.......||....::...::|.....:.|
  Fly   176 DGDH-PHPQRCEYYYRCLSGYLTIVRCPYKYGWDFPTKQCKPSSEAQC 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7248NP_648530.1 CBM_14 62..113 CDD:279884
CBM_14 136..182 CDD:279884
CBM_14 207..261 CDD:279884
CBM_14 293..347 CDD:279884 18/54 (33%)
CBM_14 367..421 CDD:279884 6/55 (11%)
CBM_14 470..522 CDD:279884 11/51 (22%)
CBM_14 544..597 CDD:279884
CBM_14 630..678 CDD:279884
CBM_14 710..758 CDD:279884
CG33263NP_996072.1 CBM_14 28..79 CDD:279884 18/53 (34%)
CBM_14 171..222 CDD:279884 11/51 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.