DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7248 and CG43218

DIOPT Version :10

Sequence 1:NP_648530.1 Gene:CG7248 / 39356 FlyBaseID:FBgn0036229 Length:796 Species:Drosophila melanogaster
Sequence 2:NP_001246864.1 Gene:CG43218 / 12798438 FlyBaseID:FBgn0262854 Length:182 Species:Drosophila melanogaster


Alignment Length:139 Identity:39/139 - (28%)
Similarity:63/139 - (45%) Gaps:22/139 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 CLGTRNNTLLPSAENCNEFYLCVNDQSKVYRCPGEMLFNPDLNIC----DDKDNVWCYGDRTTPD 192
            |.|...|.|:|..|:|:.:|:|.:...:..:||..::|:..||.|    ..:.:..|..:.|.|.
  Fly    34 CSGHLVNDLVPDCEDCSGYYICGDGSYEKVKCPQGLIFDIALNTCVLGQCPRFDGTCSANSTVPP 98

  Fly   193 PLDTTT--------------PAEESFTKCEDQEKGTFFPDPENCQQYYYCWGNKSYTILPCPVDN 243
            |:.|||              |.:...| |:.|||.  .|.|.:|:.:|.|:| |...:..|.:..
  Fly    99 PVTTTTTTAAPETIPPTPSGPCDNDVT-CQLQEKS--IPHPTHCRNFYTCYG-KCAVLGLCELGK 159

  Fly   244 WFNPISGNC 252
            ||:.....|
  Fly   160 WFDREGNVC 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7248NP_648530.1 CBM_14 62..113 CDD:426342
CBM_14 136..182 CDD:426342 13/49 (27%)
CBM_14 207..261 CDD:426342 15/46 (33%)
CBM_14 293..347 CDD:426342
CBM_14 367..421 CDD:426342
CBM_14 470..522 CDD:426342
CBM_14 544..597 CDD:426342
CBM_14 630..678 CDD:426342
CBM_14 710..758 CDD:426342
CG43218NP_001246864.1 CBM_14 34..79 CDD:426342 14/44 (32%)
CBM_14 134..177 CDD:426342 11/36 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.