DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7248 and LOC110437948

DIOPT Version :9

Sequence 1:NP_648530.1 Gene:CG7248 / 39356 FlyBaseID:FBgn0036229 Length:796 Species:Drosophila melanogaster
Sequence 2:XP_021322240.1 Gene:LOC110437948 / 110437948 -ID:- Length:195 Species:Danio rerio


Alignment Length:215 Identity:53/215 - (24%)
Similarity:77/215 - (35%) Gaps:80/215 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   437 ATSPLTTPSPTWSTLPTANTEETTTNPPDIVGICSGESDGYYATYPEVC--NKYILCASPVPIAF 499
            ||.|:...|.|:.|:|.|:.             |...:.|:|      |  ...:||    |..|
Zfish    44 ATRPVPCHSGTFVTVPQASQ-------------CWACTAGWY------CADGGRLLC----PAGF 85

  Fly   500 YCPESLFFNEALQRCVEWESSDCSNGETTTSSPGFTTPSPDTQICSNSTGLNLPYQENCQWYIYC 564
            ||||.          ..::...|..|          |.|||:.:      ::|.....|....||
Zfish    86 YCPEG----------TGYDIRPCPAG----------TYSPDSGL------ISLSECRACDGGHYC 124

  Fly   565 TDEN-SYMMGICGSEEYFDPWTGKCGFG-VSPEACREIQTTSPTVTDSTEGPTTVITPSTP--GS 625
            :.:| |.:.|.| ||.|:      |..| :||:         |...::..|....:....|  .:
Zfish   125 SLQNSSSVTGQC-SEGYY------CAQGNISPQ---------PYTQNTGVGGLCPVGHFCPQGTA 173

  Fly   626 EPDPCDGAPEG------KLV 639
            :|.||   |||      |||
Zfish   174 QPQPC---PEGTFSNRTKLV 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7248NP_648530.1 CBM_14 62..113 CDD:279884
CBM_14 136..182 CDD:279884
CBM_14 207..261 CDD:279884
CBM_14 293..347 CDD:279884
CBM_14 367..421 CDD:279884
CBM_14 470..522 CDD:279884 12/53 (23%)
CBM_14 544..597 CDD:279884 15/54 (28%)
CBM_14 630..678 CDD:279884 7/16 (44%)
CBM_14 710..758 CDD:279884
LOC110437948XP_021322240.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.