Sequence 1: | NP_648530.1 | Gene: | CG7248 / 39356 | FlyBaseID: | FBgn0036229 | Length: | 796 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021322240.1 | Gene: | LOC110437948 / 110437948 | -ID: | - | Length: | 195 | Species: | Danio rerio |
Alignment Length: | 215 | Identity: | 53/215 - (24%) |
---|---|---|---|
Similarity: | 77/215 - (35%) | Gaps: | 80/215 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 437 ATSPLTTPSPTWSTLPTANTEETTTNPPDIVGICSGESDGYYATYPEVC--NKYILCASPVPIAF 499
Fly 500 YCPESLFFNEALQRCVEWESSDCSNGETTTSSPGFTTPSPDTQICSNSTGLNLPYQENCQWYIYC 564
Fly 565 TDEN-SYMMGICGSEEYFDPWTGKCGFG-VSPEACREIQTTSPTVTDSTEGPTTVITPSTP--GS 625
Fly 626 EPDPCDGAPEG------KLV 639 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7248 | NP_648530.1 | CBM_14 | 62..113 | CDD:279884 | |
CBM_14 | 136..182 | CDD:279884 | |||
CBM_14 | 207..261 | CDD:279884 | |||
CBM_14 | 293..347 | CDD:279884 | |||
CBM_14 | 367..421 | CDD:279884 | |||
CBM_14 | 470..522 | CDD:279884 | 12/53 (23%) | ||
CBM_14 | 544..597 | CDD:279884 | 15/54 (28%) | ||
CBM_14 | 630..678 | CDD:279884 | 7/16 (44%) | ||
CBM_14 | 710..758 | CDD:279884 | |||
LOC110437948 | XP_021322240.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D487374at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |