powered by:
Protein Alignment CG7248 and LOC102554611
DIOPT Version :9
Sequence 1: | NP_648530.1 |
Gene: | CG7248 / 39356 |
FlyBaseID: | FBgn0036229 |
Length: | 796 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017455397.1 |
Gene: | LOC102554611 / 102554611 |
RGDID: | 7689627 |
Length: | 637 |
Species: | Rattus norvegicus |
Alignment Length: | 50 |
Identity: | 14/50 - (28%) |
Similarity: | 19/50 - (38%) |
Gaps: | 2/50 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 416 VSPTAC--KESGVTTASPTTTSQATSPLTTPSPTWSTLPTANTEETTTNP 463
|||... |.|......|.:|:|..||:...||.....|.:...:....|
Rat 429 VSPVGASRKASSHCDEQPHSTNQKDSPMMGQSPVHDQDPQSIRPQQAPEP 478
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D487374at33208 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.