DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-G and CG7248

DIOPT Version :9

Sequence 1:NP_648529.1 Gene:obst-G / 39355 FlyBaseID:FBgn0036228 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_648530.1 Gene:CG7248 / 39356 FlyBaseID:FBgn0036229 Length:796 Species:Drosophila melanogaster


Alignment Length:252 Identity:65/252 - (25%)
Similarity:94/252 - (37%) Gaps:54/252 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 TSLCEGKNGGLLPMFGSCKGYYVCADGNA-VTGTCEKNTLFNPLTLHCD---DPDNVDCIFDGKD 89
            |.:|....|..||...:|:.|..|.|.|: :.|.|.....|:|.|..|.   .|:  .|      
  Fly   541 TQICSNSTGLNLPYQENCQWYIYCTDENSYMMGICGSEEYFDPWTGKCGFGVSPE--AC------ 597

  Fly    90 NIVDDTSSSESDEDDDEEMAKTDPPVTVKATKKP--RPTTLDKMCAGKKDGVMLTKNGSCQEYYV 152
            ..:..||.:.:|        .|:.|.||.....|  .|..    |.|..:|.::.....|.::..
  Fly   598 REIQTTSPTVTD--------STEGPTTVITPSTPGSEPDP----CDGAPEGKLVPYPDDCSKFIQ 650

  Fly   153 CKAKKPHLRSCPDKQHFSPTRRICMKASEAKCSGGTRENKESDGPATT----------------- 200
            |....|.:..|.:.|.||.....||....|.||          .||||                 
  Fly   651 CIQPDPIVYDCREGQEFSAALERCMAPWFANCS----------IPATTIPPVTIPTTTTTTEKPS 705

  Fly   201 -GGVCSDEKENSLVAHRSDCGKFMLCSNMMFLVMDCPTGLHFNIATSRCDYPKIAKC 256
             .|:|:|:.|.|||.:..:|.|::.|.:.:.:...||.|..||.....|..|.:|.|
  Fly   706 PNGICADKAEGSLVPYPGNCSKYIACEDPIPVGYACPEGEEFNPIILTCTDPHLAGC 762

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-GNP_648529.1 CBM_14 32..83 CDD:279884 16/54 (30%)
CBM_14 132..184 CDD:279884 13/51 (25%)
CBM_14 204..256 CDD:279884 17/51 (33%)
CG7248NP_648530.1 CBM_14 62..113 CDD:279884
CBM_14 136..182 CDD:279884
CBM_14 207..261 CDD:279884
CBM_14 293..347 CDD:279884
CBM_14 367..421 CDD:279884
CBM_14 470..522 CDD:279884
CBM_14 544..597 CDD:279884 16/54 (30%)
CBM_14 630..678 CDD:279884 12/47 (26%)
CBM_14 710..758 CDD:279884 15/47 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444049
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D33909at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.