DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-G and CG13312

DIOPT Version :9

Sequence 1:NP_648529.1 Gene:obst-G / 39355 FlyBaseID:FBgn0036228 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_648260.1 Gene:CG13312 / 39010 FlyBaseID:FBgn0035931 Length:342 Species:Drosophila melanogaster


Alignment Length:255 Identity:53/255 - (20%)
Similarity:84/255 - (32%) Gaps:52/255 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GSCKGYYVCADGNAVT-------GTCEKNTLFNPLTLHCDDPDNVDCIFDGKDNIVDDTSSSESD 101
            |:|.   ||...|.:|       .:|:.:.|.......|  |....|: .|...::.....|.||
  Fly    28 GTCN---VCNTVNNLTCYSSTQMQSCQVDVLSTATPTDC--PSGYVCV-SGSSGVLCQPEDSASD 86

  Fly   102 EDDD-EEMAKTDPPVTVKATKKPRPTTLDKMCAGK---KDGVMLTKNGSCQEYYVCKAKKPHLRS 162
            ...| :|..|.|...|...|    .|....:|.|.   :|.|     |:|...|||......:..
  Fly    87 SQADCQECNKCDETQTFACT----GTQSFALCLGTDTVQDSV-----GTCASGYVCNINDTQICG 142

  Fly   163 CPDKQHFSPTRRICMKASEAKCSGGTRENKESDGPATTGGVCSDEKENSLVAHRSDCGKFML--- 224
            .| .....||   |..:.::     |.....|...:||....|....::..|.....||:.:   
  Fly   143 LP-ADGVMPT---CSYSDDS-----TTTTVSSTTSSTTAAPPSTSSASTYCAAVQSQGKYAVGYN 198

  Fly   225 ----CSNMMFLVM----------DCPTGLHFNIATSRCDYPKIAKCQTKLNESKSKSKKP 270
                |...::..:          .||..::|:.|:..|.....:.|.|....|.:.:..|
  Fly   199 AYTTCRQYIYCTLVDGSWIGQTYTCPGSMYFDSASEMCVSTMPSTCSTTATTSSTTTAAP 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-GNP_648529.1 CBM_14 32..83 CDD:279884 10/45 (22%)
CBM_14 132..184 CDD:279884 13/54 (24%)
CBM_14 204..256 CDD:279884 10/68 (15%)
CG13312NP_648260.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.