DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-G and Mur2B

DIOPT Version :10

Sequence 1:NP_648529.1 Gene:obst-G / 39355 FlyBaseID:FBgn0036228 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_569927.1 Gene:Mur2B / 31111 FlyBaseID:FBgn0025390 Length:1795 Species:Drosophila melanogaster


Alignment Length:41 Identity:13/41 - (31%)
Similarity:19/41 - (46%) Gaps:9/41 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 ADSLELTVIENPDHNSFLDEETILEDLKVMRVMSKNYVKVS 433
            |.:|.|.:...|..|      .|||.||:.:..|   ::||
  Fly   286 ASTLALIIFTKPLRN------YILETLKLKKTSS---IQVS 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-GNP_648529.1 CBM_14 32..83 CDD:426342
CBM_14 132..184 CDD:426342
CBM_14 204..256 CDD:426342
Mur2BNP_569927.1 ChtBD2 88..136 CDD:214696
CBM_14 150..197 CDD:426342
CBM_14 221..275 CDD:426342
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.