DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17826 and CG17147

DIOPT Version :9

Sequence 1:NP_648528.1 Gene:CG17826 / 39354 FlyBaseID:FBgn0036227 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001262099.1 Gene:CG17147 / 40216 FlyBaseID:FBgn0260393 Length:337 Species:Drosophila melanogaster


Alignment Length:408 Identity:99/408 - (24%)
Similarity:144/408 - (35%) Gaps:127/408 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VSKSCASGSYWNSELNICVVDDGQCRPPTCVDGEITPNPDDCAGYLECVDGIIVILTCPDGDYFN 117
            |:.|.:.|.|  .||         ||  ...:|.....|..|..|::|.||...:||||....||
  Fly    19 VALSASVGEY--EEL---------CR--LFKNGTKVRKPGTCDQYIQCYDGNGTVLTCPSNQSFN 70

  Fly   118 STLNRCVEDTCGVCN---GNGTTCTDGELKVDPTNCAGYLACSNGNWVSKQCADGAYFNAILETC 179
            .:...|| ||....|   ||.....|||...|||.|..|..|.||..::..|..|.:|:...::|
  Fly    71 PSKGSCV-DTLANSNKYCGNRCEGLDGEWVADPTECHKYFYCMNGVPLAGMCPVGQHFDERSQSC 134

  Fly   180 VQDDEGICV-----------NCKEGSTKPLADCTMYEIC-SGGKYVTKSCDSGYYWNSQSEVCDV 232
            :...:.:||           |.|..:.|   ||..|..| ..|.:.:|||.   ..:.:.|..||
  Fly   135 LYGVDSMCVDVNNICELVAENTKFRNEK---DCAYYYECDKTGNHASKSCT---VTSKKREYFDV 193

  Fly   233 DNGQC-NGNGTTCTDGE------------LKVDPTNCAGYLACS--------NGNWVSKQCADGA 276
            ::|.| ..|...||...            .|.|...|.||..|.        :..|.  ||.:|.
  Fly   194 ESGNCVEANKVECTAHSKENVCTSSTTMTFKSDQATCRGYFVCKALYPVADLDPLWT--QCPEGY 256

  Fly   277 YFNVTLETCVQDDEGICVNCKEGSTKPLADCTMYEICSGGKYVTKSCDSGYYWNSQSEVCDVDNG 341
            :|:        :|..:|.                                   |..:.||  .:.
  Fly   257 FFD--------EDRQLCA-----------------------------------NPTTVVC--THN 276

  Fly   342 QCNGNGTTCTDGELKVDPTNCAGYLACSNGNWVSKQ-CADGAYFNATLETCVQDDEGICVNCKEG 405
            :|:|.||.....    ...||..|:.|.:...|::: |....:|:.|:|.|              
  Fly   277 RCDGRGTMLVTS----SSNNCHNYIRCVDNKEVTEETCHWDHFFDETVEAC-------------- 323

  Fly   406 STKPLADCTMYEICSGGK 423
            |:|     .:|:.|..|:
  Fly   324 SSK-----IIYDKCCDGR 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17826NP_648528.1 CBM_14 36..74 CDD:279884 6/20 (30%)
ChtBD2 <89..124 CDD:214696 12/34 (35%)
CBM_14 145..184 CDD:279884 12/38 (32%)
CBM_14 251..290 CDD:279884 10/46 (22%)
CBM_14 357..396 CDD:279884 10/39 (26%)
CBM_14 463..502 CDD:279884
CBM_14 563..610 CDD:279884
CBM_14 621..670 CDD:279884
CBM_14 697..749 CDD:279884
CG17147NP_001262099.1 ChtBD2 <44..77 CDD:214696 12/32 (38%)
ChtBD2 89..136 CDD:214696 16/46 (35%)
CBM_14 278..332 CDD:279884 17/76 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444021
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.