DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17826 and CG17145

DIOPT Version :9

Sequence 1:NP_648528.1 Gene:CG17826 / 39354 FlyBaseID:FBgn0036227 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001262098.1 Gene:CG17145 / 40215 FlyBaseID:FBgn0036953 Length:334 Species:Drosophila melanogaster


Alignment Length:283 Identity:66/283 - (23%)
Similarity:108/283 - (38%) Gaps:37/283 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 NPDDCAGYLECVDGIIVILTCPDG-DYFNSTLNRCVEDTCGVCNGNGTTCTD--GELKVDPTNCA 151
            :|:.|:..:.|:|.:....||... .:|:....:||:......:....:|.|  .:...||.:|.
  Fly    41 DPESCSQSITCIDSVSYYSTCTGSTPFFDKDTGKCVKSLSTSTSSCSISCADRAKQFVADPKSCY 105

  Fly   152 GYLACSNGNW-VSKQCADGAYFNAILETCVQDDEGICVN-----C---KEG-STKPLADCTMYEI 206
            ||..|::... :...|....:|||..:.|.:..|..|..     |   |.| :...|..|.||.:
  Fly   106 GYYYCADEETALYGTCPQETHFNATTQMCSRQHESDCTTSTFEYCSIVKNGVNFDNLQGCNMYHV 170

  Fly   207 CSGGKYVTKSCDSGYYWNSQSEV-------CD---VDNGQCNGNGTTCTDGELKVDPTNCAGYLA 261
            |..|....|:|...||..|..|.       ||   :....| |..:...:.:...|...|.||..
  Fly   171 CEKGVLKDKTCSKTYYQASTGECVSKALVDCDAHPLPTDVC-GKASKPYENKFVADEATCRGYFY 234

  Fly   262 CS-------NGNWVSKQCADGAYFNVTLETCVQDDEGICVNCK-EGSTKPLA-----DCTMYEIC 313
            |:       :.|.|..||....:|:.:.:.|:......|.:.: :|.|....     .|..|..|
  Fly   235 CAKQKDGTPDPNPVWNQCPQDRFFDASSQMCITPSSVYCSHDRCDGRTASFVVSATKGCRNYLSC 299

  Fly   314 SGGKYVTKSCDSGYYWNSQSEVC 336
            |.|..|::.....|:::.|...|
  Fly   300 SDGVTVSERSCGNYFFDDQQGAC 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17826NP_648528.1 CBM_14 36..74 CDD:279884
ChtBD2 <89..124 CDD:214696 7/34 (21%)
CBM_14 145..184 CDD:279884 11/39 (28%)
CBM_14 251..290 CDD:279884 11/45 (24%)
CBM_14 357..396 CDD:279884
CBM_14 463..502 CDD:279884
CBM_14 563..610 CDD:279884
CBM_14 621..670 CDD:279884
CBM_14 697..749 CDD:279884
CG17145NP_001262098.1 CBM_14 91..142 CDD:279884 13/50 (26%)
CBM_14 278..327 CDD:279884 11/45 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444022
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.