DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17826 and CG6933

DIOPT Version :9

Sequence 1:NP_648528.1 Gene:CG17826 / 39354 FlyBaseID:FBgn0036227 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001262097.1 Gene:CG6933 / 40214 FlyBaseID:FBgn0036952 Length:363 Species:Drosophila melanogaster


Alignment Length:367 Identity:93/367 - (25%)
Similarity:132/367 - (35%) Gaps:76/367 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 VEDTCGVCNGNGTTCTDGELKVDPTNCAGYLACSNGNWVS-KQCADGAYFNAILETCVQDDEGI- 186
            ::|.|...:|.|..       .:|:||..:..|.|...|: ..|.:|..|||...:|...:..: 
  Fly    38 MDDLCQQWSGYGYI-------GNPSNCHAWGYCKNQEVVAWGTCPNGLVFNAQAGSCDYANTTVC 95

  Fly   187 -------CVNCKEGS--TKPLADCTMYEICSG-GKYVTKSCDSGYYWNSQSEVCDVDNGQCNGNG 241
                   |.|.|...  ..|| :||.|..|.| |:.....|.:|..:::.|..|..  |......
  Fly    96 STSAVETCSNVKSPMYVANPL-NCTEYAYCDGTGQISYGDCGTGGVYSASSTKCIW--GPACPQD 157

  Fly   242 TTC---TDGELKVDPTNCAGYLACSNGNWVSKQCADGA--YFNVTLETCVQDDEGICVNCKEGST 301
            |.|   .......||..|..|:.|.||...|::|:..|  |:|.....|             .||
  Fly   158 TICRFMLSNIFVGDPNQCGNYINCVNGYGTSEKCSSTANPYYNKATGNC-------------QST 209

  Fly   302 KPLADCTMYEICSGGKYVTKSCDSGYYWNSQSEVCD------VDNGQCNGNGTTCTDGELKVDPT 360
            .|         |:|....:.:.|......:.:..||      .|....||..   .|.....|..
  Fly   210 NP---------CTGEDSNSGNSDQFTVGQTNATACDEEAFKAADPLTVNGES---VDYRYVSDGV 262

  Fly   361 NCAGYLAC----SNGNWVSKQCADGAYFNATLETCVQDDEGICVN--CKEGSTKPLAD--CTMYE 417
            .|.||..|    :.|.|  .||..|..|||  ..||.....:|.:  |...:...:||  |..|.
  Fly   263 TCYGYYYCAAVNATGYW--NQCPTGTQFNA--GKCVSPASFVCTHNRCGNVNNPFMADEGCKNYT 323

  Fly   418 ICSGGKYVTKSCDSGY-YWNSQSEVCDV---DNGQCNGNGTT 455
            |||.|  :|.||.:.. |::..:.:|..   |...||...:|
  Fly   324 ICSSG--ITGSCPTNAPYYDEVNNICTTKIPDYAICNSTAST 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17826NP_648528.1 CBM_14 36..74 CDD:279884
ChtBD2 <89..124 CDD:214696 93/367 (25%)
CBM_14 145..184 CDD:279884 12/39 (31%)
CBM_14 251..290 CDD:279884 13/40 (33%)
CBM_14 357..396 CDD:279884 15/42 (36%)
CBM_14 463..502 CDD:279884
CBM_14 563..610 CDD:279884
CBM_14 621..670 CDD:279884
CBM_14 697..749 CDD:279884
CG6933NP_001262097.1 ChtBD2 44..90 CDD:214696 14/52 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444083
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.